SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC37125 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC37125
Domain Number 1 Region: 5-98
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.91e-17
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) APC37125
Sequence length 115
Comment $ MCSG $ SQ200723 $ PDBT72057 $
Sequence
MIEISTSATSTTVTIEGDLDLSTRPQFHAATAKLGAVRRPLLVIDASRITFLDSTGAAFL
ISLADATRKRGGAAVLRGADERVLFVLETCGALDFFRLDPEPGLQEGDGGTRLRG
Download sequence
Identical sequences C5C335
gi|229822115|ref|YP_002883641.1| WP_015884116.1.13559 471853.Bcav_3637 APC37125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]