SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC37163 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC37163
Domain Number 1 Region: 3-100
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000000102
Family Anti-sigma factor antagonist SpoIIaa 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) APC37163
Sequence length 121
Comment $ MCSG $ SQ200770 $ PDBT72104 $
Sequence
MIEISTSSTTTTLLVAGDLDLAEREQFPEVTARVVGLRRQLLVIDMCRVTFMDSTGAAFL
ISLADAGRRRGGATVLRGAADRDLFVLEICGALELFRIDADHHCELGAELPSAPEGAPAP
A
Download sequence
Identical sequences D5UKI7
APC37163 gi|296130797|ref|YP_003638047.1| WP_013118179.1.68649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]