SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC37303 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC37303
Domain Number 1 Region: 10-98
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.73e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) APC37303
Sequence length 111
Comment $ MCSG $ SQ200916 $ PDBT72251 $
Sequence
MFEIATTPMATTVVISGDLDLASRDQFLEVAARLTSLRRSLLTIDMCDVRFMDSTGAAFL
ISLAETGQRRGWLTVLRGSSDAHRFVLDICGATHLFRFDTEHYCHHTASPA
Download sequence
Identical sequences C7R2Q8
APC37303 471856.Jden_2417 gi|256833625|ref|YP_003162352.1| WP_015772660.1.34072 WP_015772660.1.39474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]