SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for APC38317.1 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  APC38317.1
Domain Number - Region: 82-145
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0223
Family PF0610-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC38317.1
Sequence length 150
Comment $ MCSG $ SQ203701 $ PDBT74084 $
Sequence
LVSSLSERLRHGERDIDALVTQAREKIVRAGDLTQSEIESVIAAVKRDLEEFARSYEESH
EDESDSVFMRVIKESLWQELADITDKTQLEWREVFQDLNHHGVYHSGEVVGLGNLVCEKC
HYHLAVYTPDVLPRCPKCGHDQFQRRPFEP
Download sequence
Identical sequences APC38317.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]