SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC40885.0 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC40885.0
Domain Number 1 Region: 6-98
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.34e-19
Family Anti-sigma factor antagonist SpoIIaa 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) APC40885.0
Sequence length 125
Comment $ MCSG $ SQ223263 $ PDBT77746 $
Sequence
MALPQLNVHRHDRNTHALLTLAGEIDLTTAPLVRAALTECLRDGIRTVDVDLTAITFCDG
SGLNAFLTAYQIAHEAGTTVQLHHPPPPTARVIEITGSGFLLHELHALPRTPAARRVPAA
SGGAL
Download sequence
Identical sequences Q82E29
227882.SAV_4787 WP_010986210.1.19017 WP_010986210.1.30226 WP_010986210.1.49792 WP_010986210.1.60620 WP_010986210.1.68722 APC40885.0 gi|29831330|ref|NP_825964.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]