SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC40887.0 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC40887.0
Domain Number 1 Region: 3-110
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.32e-31
Family Anti-sigma factor antagonist SpoIIaa 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) APC40887.0
Sequence length 113
Comment $ MCSG $ SQ223269 $ PDBT77752 $
Sequence
MDLSLSTRTVGDRTVVEVGGEIDVYTAPKLREQLVELVNDGNFHLVVDMEGVDFLDSTGL
GVLVGGLKRVRAHEGSLRLVCNQERILKIFRITGLTKVFPIHTSVEEAVAATD
Download sequence
Identical sequences A0A0B5DKS1 A0A0C5GEA7 A0A0G3ACT4 A0A0N1FJR1 A0A0X3RPW3 A0A117PU95 A0A117R8U5 A0A177HLD1 A0A1C5EQR2 A0A1H4Z740 A0A1H4ZE69 A0A1H5LZK0 A0A1I2X8V6 A0A1J4Q4H0 A0A1K2G1C3 A0A1Q5JVI4 A0A1S2P9N4 A0A1V1YF03 A0A1X4GSP7 A0A221NYT5 A0A233SDS6 A0A250VGP3 A0A286FNK7 A0A2A3J824 A0A2C8XB49 A0A2G7ALP2 A0A2G7BYY2 Q82EK0 S5UYU2
gi|529226901|ref|YP_008387722.1| 227882.SAV_4614 gi|29831157|ref|NP_825791.1| WP_010986038.1.15750 WP_010986038.1.19017 WP_010986038.1.19294 WP_010986038.1.20343 WP_010986038.1.21785 WP_010986038.1.2222 WP_010986038.1.22376 WP_010986038.1.22986 WP_010986038.1.24031 WP_010986038.1.25901 WP_010986038.1.2630 WP_010986038.1.26550 WP_010986038.1.28616 WP_010986038.1.29235 WP_010986038.1.30226 WP_010986038.1.3177 WP_010986038.1.33184 WP_010986038.1.35991 WP_010986038.1.40943 WP_010986038.1.4228 WP_010986038.1.47120 WP_010986038.1.48949 WP_010986038.1.49792 WP_010986038.1.50328 WP_010986038.1.53666 WP_010986038.1.55497 WP_010986038.1.56970 WP_010986038.1.57749 WP_010986038.1.60620 WP_010986038.1.62098 WP_010986038.1.66602 WP_010986038.1.66672 WP_010986038.1.66741 WP_010986038.1.68722 WP_010986038.1.73892 WP_010986038.1.78460 WP_010986038.1.78468 WP_010986038.1.79272 WP_010986038.1.81155 WP_010986038.1.90918 WP_010986038.1.93187 WP_010986038.1.95107 WP_010986038.1.98377 WP_010986038.1.99541 WP_010986038.1.99743 WP_010986038.1.99784 APC40887.0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]