SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC40988.0 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC40988.0
Domain Number 1 Region: 6-112
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.12e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) APC40988.0
Sequence length 124
Comment $ MCSG $ SQ223493 $ PDBT77984 $
Sequence
MSVEAEVTVTVVDDVRIVRVAGDYDAVGAETLAHALALPAETGTSGTVVDLAKVTFADSS
FLHTLLAAQYRHQTSGIPLVLAEVTPVLQRLLDLTDVTRAFTVAQTVPTATETVHARKSS
TRRQ
Download sequence
Identical sequences Q9RD40
100226.SCO0869 APC40988.0 NP_625169.1.49638 gi|21219390|ref|NP_625169.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]