SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC40989.0 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC40989.0
Domain Number 1 Region: 80-181
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.9e-22
Family Anti-sigma factor antagonist SpoIIaa 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC40989.0
Sequence length 183
Comment $ MCSG $ SQ223496 $ PDBT77987 $
Sequence
MCHHTSDRSQRNAVARAEPGGAGSGRCVPVRTSGPTRAAKGLNIEPPDDGRAHAAHARSE
GSVAEIEGAAVPERLLITRTTTGDGVCLVILAGEVDLDGSGHLRDVLLSSVESAPGTVVD
FGEVGFLDSSGINVLISAHRAAESRGVFFRLAAPRDAVERVLRLVGVDALIPCYPSVEQA
LTA
Download sequence
Identical sequences Q9RJ93
NP_624981.1.49638 WP_003978190.1.26049 WP_003978190.1.30910 WP_003978190.1.43399 WP_003978190.1.55229 WP_003978190.1.58943 WP_003978190.1.86682 APC40989.0 100226.SCO0672 gi|21219202|ref|NP_624981.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]