SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for APC4391 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC4391
Domain Number 1 Region: 2-82
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.3e-22
Family Extended AAA-ATPase domain 0.00000828
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) APC4391
Sequence length 82
Comment $ MCSG $ SQ125999 $ PDBT56421 $
Sequence
DVLEIDPEGENIGIDDIRTIKDFLNYSPELYTRKYVIVHDCERMTQQAANAFLKALEEPP
EYAVIVLNTRRWHYLLPTIKSR
Download sequence
Identical sequences APC4391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]