SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC4750 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC4750
Domain Number 1 Region: 1-110
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.29e-29
Family Anti-sigma factor antagonist SpoIIaa 0.0000011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC4750
Sequence length 110
Comment $ MCSG $ SQ10992 $ PDBT56796 $
Sequence
MNNLKLDIVEQDDKAIVRVQGDIDAYNSSELKEQLRNFISTTSKKKIVLDLSSVSYMDSA
GLGTLVVILKDAKINGKEFILSSLKESISRILKLTHLDKIFKITDTVEEA
Download sequence
Identical sequences A0A0A6N0L9 A0A0F6AM60 A0A101F9I4 A0A124FFW6 D2C3Z9 G4FFH7 Q9X1F5
gi|15644192|ref|NP_229241.1| 000011464|e1vc1A1|2496.1.1.4|A:1-110 000118100|e1t6rA1|2496.1.1.4|A:1-110 000118101|e1vc1B1|2496.1.1.4|B:1-110 000118102|e1sboA1|2496.1.1.4|A:1-110 cath|current|1sboA00/1-110 cath|current|1vc1A00/1-110 cath|current|1vc1B00/1-110 d1sboa_ d1t6ra_ d1vc1a_ d1vc1b_ 126740.TRQ2_1334 243274.TM1442 590168.Tnap_1370 1sbo_A 1t6r_A 1vc1_A 1vc1_B NP_229241.1.35502 WP_004081714.1.100023 WP_004081714.1.18251 WP_004081714.1.1950 WP_004081714.1.29620 WP_004081714.1.32102 WP_004081714.1.43545 WP_004081714.1.44660 WP_004081714.1.45724 WP_004081714.1.5118 WP_004081714.1.51363 WP_004081714.1.51822 WP_004081714.1.56403 WP_004081714.1.75526 WP_004081714.1.79805 gi|281412788|ref|YP_003346867.1| 283301 APC4750 gi|170289123|ref|YP_001739361.1| 1vc1A gi|15644192|ref|NP_229241.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]