SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC5647 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC5647
Domain Number 1 Region: 6-106
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000275
Family Anti-sigma factor antagonist SpoIIaa 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) APC5647
Sequence length 160
Comment $ MCSG $ SQ15761 $ PDBT57166 $
Sequence
MSTGKIQFAEQNGSFVLKFVGEVRLTLCSALDSTIEKIFAALNFSAIIIDLTETQSIDST
TLGLLAKLSILSRQKIGLLPTLVTTNPDITRLLQSMGFDQVFNIVDRPIPCPECLSDLPP
QDQSEDVVRDKVLEAHRILMGLNESNREAFHDLVSALERH
Download sequence
Identical sequences A0A072ZT60 A0A0E1AW45 A0A0H2ZCN9 A0A0H3R3B6 A0A157W7S9 A0A1C7BQL2 A0A1E9CNS4 A0A1F0J639 A0A1G5KNH4 A0A1S1C547 Q9I046 W1MK55
gi|564952082|ref|YP_008884652.1| gi|386058229|ref|YP_005974751.1| gi|116050797|ref|YP_790382.1| gi|15597993|ref|NP_251487.1| gi|392983488|ref|YP_006482075.1| gi|558672926|ref|YP_008809634.1| gi|558666575|ref|YP_008803285.1| 208963.PA14_27950 208964.PA2797 557722.PLES_22751 gi|218891012|ref|YP_002439878.1| gi|568153414|ref|YP_008942375.1| APC5647 NP_251487.1.87394 WP_003104052.1.100071 WP_003104052.1.100100 WP_003104052.1.100179 WP_003104052.1.100276 WP_003104052.1.100278 WP_003104052.1.100319 WP_003104052.1.100394 WP_003104052.1.100420 WP_003104052.1.100456 WP_003104052.1.100473 WP_003104052.1.100523 WP_003104052.1.100654 WP_003104052.1.100723 WP_003104052.1.100742 WP_003104052.1.100777 WP_003104052.1.100786 WP_003104052.1.100808 WP_003104052.1.100809 WP_003104052.1.100810 WP_003104052.1.100872 WP_003104052.1.100983 WP_003104052.1.100995 WP_003104052.1.101021 WP_003104052.1.101047 WP_003104052.1.101090 WP_003104052.1.101269 WP_003104052.1.101310 WP_003104052.1.101340 WP_003104052.1.101506 WP_003104052.1.101572 WP_003104052.1.101642 WP_003104052.1.101712 WP_003104052.1.101739 WP_003104052.1.10179 WP_003104052.1.101809 WP_003104052.1.101819 WP_003104052.1.10185 WP_003104052.1.101863 WP_003104052.1.101871 WP_003104052.1.10201 WP_003104052.1.10204 WP_003104052.1.102045 WP_003104052.1.10248 WP_003104052.1.10257 WP_003104052.1.1037 WP_003104052.1.10407 WP_003104052.1.10435 WP_003104052.1.10457 WP_003104052.1.10468 WP_003104052.1.10477 WP_003104052.1.10482 WP_003104052.1.10513 WP_003104052.1.10529 WP_003104052.1.10548 WP_003104052.1.10572 WP_003104052.1.10575 WP_003104052.1.10636 WP_003104052.1.10641 WP_003104052.1.10684 WP_003104052.1.10856 WP_003104052.1.10895 WP_003104052.1.10901 WP_003104052.1.10949 WP_003104052.1.11026 WP_003104052.1.11058 WP_003104052.1.1107 WP_003104052.1.11077 WP_003104052.1.1109 WP_003104052.1.11163 WP_003104052.1.11178 WP_003104052.1.11180 WP_003104052.1.11318 WP_003104052.1.11381 WP_003104052.1.11388 WP_003104052.1.11410 WP_003104052.1.11417 WP_003104052.1.11454 WP_003104052.1.11568 WP_003104052.1.11569 WP_003104052.1.11653 WP_003104052.1.11744 WP_003104052.1.11754 WP_003104052.1.1180 WP_003104052.1.11847 WP_003104052.1.11854 WP_003104052.1.1187 WP_003104052.1.11943 WP_003104052.1.12018 WP_003104052.1.12081 WP_003104052.1.12120 WP_003104052.1.12150 WP_003104052.1.12208 WP_003104052.1.12240 WP_003104052.1.12302 WP_003104052.1.12354 WP_003104052.1.1238 WP_003104052.1.12400 WP_003104052.1.12482 WP_003104052.1.12497 WP_003104052.1.12530 WP_003104052.1.12547 WP_003104052.1.12561 WP_003104052.1.12657 WP_003104052.1.12670 WP_003104052.1.12687 WP_003104052.1.12744 WP_003104052.1.12797 WP_003104052.1.12838 WP_003104052.1.12873 WP_003104052.1.12891 WP_003104052.1.12922 WP_003104052.1.12930 WP_003104052.1.12970 WP_003104052.1.12980 WP_003104052.1.13 WP_003104052.1.13041 WP_003104052.1.1305 WP_003104052.1.13057 WP_003104052.1.13085 WP_003104052.1.13092 WP_003104052.1.13208 WP_003104052.1.13232 WP_003104052.1.13242 WP_003104052.1.13266 WP_003104052.1.13315 WP_003104052.1.1333 WP_003104052.1.13407 WP_003104052.1.13529 WP_003104052.1.13533 WP_003104052.1.1356 WP_003104052.1.1362 WP_003104052.1.13622 WP_003104052.1.13718 WP_003104052.1.13743 WP_003104052.1.13758 WP_003104052.1.13765 WP_003104052.1.13785 WP_003104052.1.13795 WP_003104052.1.13828 WP_003104052.1.13865 WP_003104052.1.1393 WP_003104052.1.14049 WP_003104052.1.14078 WP_003104052.1.14096 WP_003104052.1.14204 WP_003104052.1.14251 WP_003104052.1.14378 WP_003104052.1.14424 WP_003104052.1.14455 WP_003104052.1.14460 WP_003104052.1.14463 WP_003104052.1.14476 WP_003104052.1.14525 WP_003104052.1.14564 WP_003104052.1.14615 WP_003104052.1.14640 WP_003104052.1.14714 WP_003104052.1.1475 WP_003104052.1.14754 WP_003104052.1.14797 WP_003104052.1.14815 WP_003104052.1.14820 WP_003104052.1.14835 WP_003104052.1.14839 WP_003104052.1.14883 WP_003104052.1.14966 WP_003104052.1.14981 WP_003104052.1.15130 WP_003104052.1.152 WP_003104052.1.15222 WP_003104052.1.15231 WP_003104052.1.15281 WP_003104052.1.15297 WP_003104052.1.15328 WP_003104052.1.15373 WP_003104052.1.15379 WP_003104052.1.15474 WP_003104052.1.15480 WP_003104052.1.15482 WP_003104052.1.15485 WP_003104052.1.15602 WP_003104052.1.15606 WP_003104052.1.15692 WP_003104052.1.15886 WP_003104052.1.15889 WP_003104052.1.16041 WP_003104052.1.16074 WP_003104052.1.16109 WP_003104052.1.16142 WP_003104052.1.16161 WP_003104052.1.16197 WP_003104052.1.162 WP_003104052.1.16239 WP_003104052.1.16242 WP_003104052.1.16267 WP_003104052.1.16279 WP_003104052.1.16419 WP_003104052.1.1646 WP_003104052.1.16660 WP_003104052.1.16694 WP_003104052.1.1670 WP_003104052.1.1671 WP_003104052.1.16751 WP_003104052.1.16782 WP_003104052.1.16808 WP_003104052.1.16811 WP_003104052.1.16895 WP_003104052.1.17022 WP_003104052.1.17108 WP_003104052.1.17155 WP_003104052.1.17162 WP_003104052.1.17177 WP_003104052.1.172 WP_003104052.1.17223 WP_003104052.1.17353 WP_003104052.1.17354 WP_003104052.1.17370 WP_003104052.1.1739 WP_003104052.1.17397 WP_003104052.1.17566 WP_003104052.1.1758 WP_003104052.1.1761 WP_003104052.1.17697 WP_003104052.1.17883 WP_003104052.1.17890 WP_003104052.1.18052 WP_003104052.1.18054 WP_003104052.1.18117 WP_003104052.1.18156 WP_003104052.1.18157 WP_003104052.1.18199 WP_003104052.1.18204 WP_003104052.1.18234 WP_003104052.1.1824 WP_003104052.1.18349 WP_003104052.1.18440 WP_003104052.1.18493 WP_003104052.1.18508 WP_003104052.1.18547 WP_003104052.1.18653 WP_003104052.1.18728 WP_003104052.1.18735 WP_003104052.1.18769 WP_003104052.1.18795 WP_003104052.1.18852 WP_003104052.1.18892 WP_003104052.1.18907 WP_003104052.1.18911 WP_003104052.1.18930 WP_003104052.1.190 WP_003104052.1.19089 WP_003104052.1.19199 WP_003104052.1.19251 WP_003104052.1.19260 WP_003104052.1.19269 WP_003104052.1.19346 WP_003104052.1.19351 WP_003104052.1.19376 WP_003104052.1.1938 WP_003104052.1.19552 WP_003104052.1.19591 WP_003104052.1.19640 WP_003104052.1.19703 WP_003104052.1.1971 WP_003104052.1.19718 WP_003104052.1.19741 WP_003104052.1.19771 WP_003104052.1.19803 WP_003104052.1.19824 WP_003104052.1.19930 WP_003104052.1.19931 WP_003104052.1.20024 WP_003104052.1.20070 WP_003104052.1.2012 WP_003104052.1.20125 WP_003104052.1.20134 WP_003104052.1.20154 WP_003104052.1.20216 WP_003104052.1.20342 WP_003104052.1.20682 WP_003104052.1.20692 WP_003104052.1.20744 WP_003104052.1.20764 WP_003104052.1.20825 WP_003104052.1.20854 WP_003104052.1.20880 WP_003104052.1.20884 WP_003104052.1.20890 WP_003104052.1.209 WP_003104052.1.20929 WP_003104052.1.20978 WP_003104052.1.21039 WP_003104052.1.21096 WP_003104052.1.21100 WP_003104052.1.21166 WP_003104052.1.21209 WP_003104052.1.21242 WP_003104052.1.21253 WP_003104052.1.21302 WP_003104052.1.21349 WP_003104052.1.21358 WP_003104052.1.2144 WP_003104052.1.21448 WP_003104052.1.21460 WP_003104052.1.21469 WP_003104052.1.21471 WP_003104052.1.21517 WP_003104052.1.21718 WP_003104052.1.2172 WP_003104052.1.21744 WP_003104052.1.21767 WP_003104052.1.21782 WP_003104052.1.21801 WP_003104052.1.21863 WP_003104052.1.21871 WP_003104052.1.21891 WP_003104052.1.21932 WP_003104052.1.22078 WP_003104052.1.221 WP_003104052.1.2228 WP_003104052.1.22316 WP_003104052.1.22324 WP_003104052.1.22365 WP_003104052.1.22390 WP_003104052.1.22394 WP_003104052.1.22442 WP_003104052.1.22477 WP_003104052.1.22491 WP_003104052.1.22573 WP_003104052.1.22671 WP_003104052.1.22704 WP_003104052.1.22729 WP_003104052.1.22863 WP_003104052.1.2289 WP_003104052.1.22891 WP_003104052.1.23013 WP_003104052.1.23166 WP_003104052.1.23191 WP_003104052.1.23195 WP_003104052.1.2323 WP_003104052.1.23264 WP_003104052.1.23331 WP_003104052.1.23394 WP_003104052.1.23418 WP_003104052.1.23421 WP_003104052.1.23512 WP_003104052.1.23518 WP_003104052.1.23523 WP_003104052.1.23525 WP_003104052.1.23559 WP_003104052.1.23581 WP_003104052.1.236 WP_003104052.1.23611 WP_003104052.1.23641 WP_003104052.1.23715 WP_003104052.1.23739 WP_003104052.1.2374 WP_003104052.1.23769 WP_003104052.1.23782 WP_003104052.1.23794 WP_003104052.1.23884 WP_003104052.1.23925 WP_003104052.1.23961 WP_003104052.1.23967 WP_003104052.1.23983 WP_003104052.1.24066 WP_003104052.1.24077 WP_003104052.1.24087 WP_003104052.1.24101 WP_003104052.1.24183 WP_003104052.1.24234 WP_003104052.1.24351 WP_003104052.1.24382 WP_003104052.1.24413 WP_003104052.1.24447 WP_003104052.1.2453 WP_003104052.1.24626 WP_003104052.1.24662 WP_003104052.1.2477 WP_003104052.1.24851 WP_003104052.1.24862 WP_003104052.1.24869 WP_003104052.1.24879 WP_003104052.1.24938 WP_003104052.1.24940 WP_003104052.1.25033 WP_003104052.1.25052 WP_003104052.1.25067 WP_003104052.1.25075 WP_003104052.1.251 WP_003104052.1.25109 WP_003104052.1.2511 WP_003104052.1.25142 WP_003104052.1.25149 WP_003104052.1.25179 WP_003104052.1.25191 WP_003104052.1.25271 WP_003104052.1.2529 WP_003104052.1.2530 WP_003104052.1.25328 WP_003104052.1.25344 WP_003104052.1.25348 WP_003104052.1.2535 WP_003104052.1.25477 WP_003104052.1.25532 WP_003104052.1.25600 WP_003104052.1.25675 WP_003104052.1.25695 WP_003104052.1.2572 WP_003104052.1.25834 WP_003104052.1.25903 WP_003104052.1.2596 WP_003104052.1.25964 WP_003104052.1.26010 WP_003104052.1.26025 WP_003104052.1.26042 WP_003104052.1.261 WP_003104052.1.26159 WP_003104052.1.26301 WP_003104052.1.26334 WP_003104052.1.26428 WP_003104052.1.26463 WP_003104052.1.26489 WP_003104052.1.2652 WP_003104052.1.26539 WP_003104052.1.26592 WP_003104052.1.26604 WP_003104052.1.26681 WP_003104052.1.26705 WP_003104052.1.26740 WP_003104052.1.26816 WP_003104052.1.26841 WP_003104052.1.26862 WP_003104052.1.26906 WP_003104052.1.26967 WP_003104052.1.2698 WP_003104052.1.27018 WP_003104052.1.27028 WP_003104052.1.27039 WP_003104052.1.27073 WP_003104052.1.27107 WP_003104052.1.27211 WP_003104052.1.27218 WP_003104052.1.27259 WP_003104052.1.27505 WP_003104052.1.27534 WP_003104052.1.27575 WP_003104052.1.27587 WP_003104052.1.27687 WP_003104052.1.27738 WP_003104052.1.27772 WP_003104052.1.27783 WP_003104052.1.27825 WP_003104052.1.27837 WP_003104052.1.27858 WP_003104052.1.27939 WP_003104052.1.27966 WP_003104052.1.28006 WP_003104052.1.28057 WP_003104052.1.28064 WP_003104052.1.28078 WP_003104052.1.28136 WP_003104052.1.28175 WP_003104052.1.28193 WP_003104052.1.28258 WP_003104052.1.283 WP_003104052.1.28316 WP_003104052.1.28329 WP_003104052.1.28372 WP_003104052.1.28382 WP_003104052.1.28383 WP_003104052.1.28404 WP_003104052.1.28468 WP_003104052.1.28505 WP_003104052.1.28528 WP_003104052.1.28560 WP_003104052.1.28602 WP_003104052.1.28623 WP_003104052.1.28699 WP_003104052.1.28713 WP_003104052.1.28757 WP_003104052.1.28800 WP_003104052.1.28823 WP_003104052.1.28838 WP_003104052.1.28849 WP_003104052.1.29003 WP_003104052.1.29062 WP_003104052.1.29096 WP_003104052.1.29127 WP_003104052.1.29137 WP_003104052.1.29158 WP_003104052.1.29179 WP_003104052.1.29208 WP_003104052.1.2927 WP_003104052.1.29401 WP_003104052.1.2941 WP_003104052.1.29438 WP_003104052.1.29440 WP_003104052.1.29472 WP_003104052.1.2948 WP_003104052.1.29481 WP_003104052.1.29498 WP_003104052.1.29501 WP_003104052.1.29577 WP_003104052.1.2961 WP_003104052.1.29633 WP_003104052.1.29668 WP_003104052.1.29753 WP_003104052.1.29767 WP_003104052.1.2980 WP_003104052.1.29848 WP_003104052.1.29920 WP_003104052.1.29958 WP_003104052.1.29973 WP_003104052.1.30000 WP_003104052.1.30081 WP_003104052.1.30120 WP_003104052.1.30254 WP_003104052.1.30365 WP_003104052.1.30474 WP_003104052.1.30475 WP_003104052.1.30563 WP_003104052.1.30567 WP_003104052.1.30614 WP_003104052.1.30615 WP_003104052.1.30625 WP_003104052.1.30693 WP_003104052.1.30707 WP_003104052.1.3072 WP_003104052.1.30740 WP_003104052.1.30797 WP_003104052.1.30815 WP_003104052.1.30886 WP_003104052.1.30943 WP_003104052.1.30973 WP_003104052.1.30994 WP_003104052.1.31045 WP_003104052.1.31076 WP_003104052.1.31087 WP_003104052.1.31103 WP_003104052.1.31105 WP_003104052.1.31138 WP_003104052.1.31147 WP_003104052.1.31279 WP_003104052.1.31361 WP_003104052.1.31457 WP_003104052.1.31501 WP_003104052.1.31563 WP_003104052.1.31565 WP_003104052.1.31587 WP_003104052.1.31655 WP_003104052.1.31732 WP_003104052.1.31741 WP_003104052.1.3179 WP_003104052.1.31848 WP_003104052.1.31852 WP_003104052.1.3189 WP_003104052.1.319 WP_003104052.1.31939 WP_003104052.1.32134 WP_003104052.1.32137 WP_003104052.1.32144 WP_003104052.1.32289 WP_003104052.1.32314 WP_003104052.1.32359 WP_003104052.1.32447 WP_003104052.1.32523 WP_003104052.1.32544 WP_003104052.1.32596 WP_003104052.1.32641 WP_003104052.1.32711 WP_003104052.1.32821 WP_003104052.1.32869 WP_003104052.1.32879 WP_003104052.1.32998 WP_003104052.1.33009 WP_003104052.1.33047 WP_003104052.1.33097 WP_003104052.1.33133 WP_003104052.1.33152 WP_003104052.1.33186 WP_003104052.1.33204 WP_003104052.1.33210 WP_003104052.1.33216 WP_003104052.1.33294 WP_003104052.1.33340 WP_003104052.1.33387 WP_003104052.1.33438 WP_003104052.1.33441 WP_003104052.1.33455 WP_003104052.1.3351 WP_003104052.1.33517 WP_003104052.1.33521 WP_003104052.1.33523 WP_003104052.1.33549 WP_003104052.1.33653 WP_003104052.1.33658 WP_003104052.1.33669 WP_003104052.1.3368 WP_003104052.1.33733 WP_003104052.1.33734 WP_003104052.1.3376 WP_003104052.1.33774 WP_003104052.1.33801 WP_003104052.1.33814 WP_003104052.1.33822 WP_003104052.1.33824 WP_003104052.1.33833 WP_003104052.1.3385 WP_003104052.1.34000 WP_003104052.1.34039 WP_003104052.1.34136 WP_003104052.1.34143 WP_003104052.1.34151 WP_003104052.1.34180 WP_003104052.1.34191 WP_003104052.1.34203 WP_003104052.1.34306 WP_003104052.1.34317 WP_003104052.1.34324 WP_003104052.1.3436 WP_003104052.1.34401 WP_003104052.1.34402 WP_003104052.1.34461 WP_003104052.1.34465 WP_003104052.1.34472 WP_003104052.1.3452 WP_003104052.1.34556 WP_003104052.1.34568 WP_003104052.1.34583 WP_003104052.1.34625 WP_003104052.1.34689 WP_003104052.1.34784 WP_003104052.1.34821 WP_003104052.1.34832 WP_003104052.1.34836 WP_003104052.1.34837 WP_003104052.1.34878 WP_003104052.1.34901 WP_003104052.1.34922 WP_003104052.1.35036 WP_003104052.1.35104 WP_003104052.1.35149 WP_003104052.1.35231 WP_003104052.1.35281 WP_003104052.1.3531 WP_003104052.1.35325 WP_003104052.1.35353 WP_003104052.1.3540 WP_003104052.1.35431 WP_003104052.1.35442 WP_003104052.1.35480 WP_003104052.1.35512 WP_003104052.1.35573 WP_003104052.1.35599 WP_003104052.1.35639 WP_003104052.1.35641 WP_003104052.1.35669 WP_003104052.1.35679 WP_003104052.1.3568 WP_003104052.1.35682 WP_003104052.1.3576 WP_003104052.1.35762 WP_003104052.1.35768 WP_003104052.1.35822 WP_003104052.1.35843 WP_003104052.1.35857 WP_003104052.1.35872 WP_003104052.1.35968 WP_003104052.1.35984 WP_003104052.1.36064 WP_003104052.1.36121 WP_003104052.1.36148 WP_003104052.1.36170 WP_003104052.1.36266 WP_003104052.1.36267 WP_003104052.1.36378 WP_003104052.1.36435 WP_003104052.1.36487 WP_003104052.1.36521 WP_003104052.1.3653 WP_003104052.1.36587 WP_003104052.1.36608 WP_003104052.1.3662 WP_003104052.1.36630 WP_003104052.1.36665 WP_003104052.1.36708 WP_003104052.1.3672 WP_003104052.1.36781 WP_003104052.1.36879 WP_003104052.1.37050 WP_003104052.1.37097 WP_003104052.1.37125 WP_003104052.1.37163 WP_003104052.1.37172 WP_003104052.1.37208 WP_003104052.1.3721 WP_003104052.1.37216 WP_003104052.1.373 WP_003104052.1.37319 WP_003104052.1.37366 WP_003104052.1.37416 WP_003104052.1.37500 WP_003104052.1.37512 WP_003104052.1.37571 WP_003104052.1.3768 WP_003104052.1.37698 WP_003104052.1.37703 WP_003104052.1.3773 WP_003104052.1.37799 WP_003104052.1.3781 WP_003104052.1.37814 WP_003104052.1.37818 WP_003104052.1.37826 WP_003104052.1.37842 WP_003104052.1.3785 WP_003104052.1.3792 WP_003104052.1.38003 WP_003104052.1.38023 WP_003104052.1.38060 WP_003104052.1.38087 WP_003104052.1.38102 WP_003104052.1.38146 WP_003104052.1.38151 WP_003104052.1.3818 WP_003104052.1.38186 WP_003104052.1.3821 WP_003104052.1.38319 WP_003104052.1.3833 WP_003104052.1.38337 WP_003104052.1.38406 WP_003104052.1.38430 WP_003104052.1.38450 WP_003104052.1.38502 WP_003104052.1.38505 WP_003104052.1.38510 WP_003104052.1.38582 WP_003104052.1.38583 WP_003104052.1.38587 WP_003104052.1.38657 WP_003104052.1.38661 WP_003104052.1.3870 WP_003104052.1.38706 WP_003104052.1.38727 WP_003104052.1.38816 WP_003104052.1.38834 WP_003104052.1.3887 WP_003104052.1.38889 WP_003104052.1.38932 WP_003104052.1.38971 WP_003104052.1.39046 WP_003104052.1.39088 WP_003104052.1.39122 WP_003104052.1.39186 WP_003104052.1.39271 WP_003104052.1.39326 WP_003104052.1.39345 WP_003104052.1.3943 WP_003104052.1.39444 WP_003104052.1.39452 WP_003104052.1.39458 WP_003104052.1.39537 WP_003104052.1.39704 WP_003104052.1.39765 WP_003104052.1.39786 WP_003104052.1.39811 WP_003104052.1.39949 WP_003104052.1.3998 WP_003104052.1.39989 WP_003104052.1.40059 WP_003104052.1.40135 WP_003104052.1.40207 WP_003104052.1.40213 WP_003104052.1.40237 WP_003104052.1.40243 WP_003104052.1.4038 WP_003104052.1.40419 WP_003104052.1.40442 WP_003104052.1.40512 WP_003104052.1.40513 WP_003104052.1.40541 WP_003104052.1.40546 WP_003104052.1.4058 WP_003104052.1.40595 WP_003104052.1.40703 WP_003104052.1.40874 WP_003104052.1.40950 WP_003104052.1.40984 WP_003104052.1.40993 WP_003104052.1.40994 WP_003104052.1.41110 WP_003104052.1.41291 WP_003104052.1.41301 WP_003104052.1.41384 WP_003104052.1.41429 WP_003104052.1.41487 WP_003104052.1.41492 WP_003104052.1.4156 WP_003104052.1.41618 WP_003104052.1.41624 WP_003104052.1.41625 WP_003104052.1.41692 WP_003104052.1.41703 WP_003104052.1.41725 WP_003104052.1.41732 WP_003104052.1.41748 WP_003104052.1.41773 WP_003104052.1.41832 WP_003104052.1.41846 WP_003104052.1.41871 WP_003104052.1.41888 WP_003104052.1.4190 WP_003104052.1.41939 WP_003104052.1.4196 WP_003104052.1.42 WP_003104052.1.42019 WP_003104052.1.42041 WP_003104052.1.42047 WP_003104052.1.42146 WP_003104052.1.42259 WP_003104052.1.42294 WP_003104052.1.42316 WP_003104052.1.42388 WP_003104052.1.42411 WP_003104052.1.42423 WP_003104052.1.42463 WP_003104052.1.42499 WP_003104052.1.42508 WP_003104052.1.42634 WP_003104052.1.42643 WP_003104052.1.42696 WP_003104052.1.42754 WP_003104052.1.42757 WP_003104052.1.42778 WP_003104052.1.42789 WP_003104052.1.42854 WP_003104052.1.42856 WP_003104052.1.42870 WP_003104052.1.42917 WP_003104052.1.42952 WP_003104052.1.42972 WP_003104052.1.42973 WP_003104052.1.43022 WP_003104052.1.43024 WP_003104052.1.43026 WP_003104052.1.43049 WP_003104052.1.43106 WP_003104052.1.43107 WP_003104052.1.43286 WP_003104052.1.43293 WP_003104052.1.43315 WP_003104052.1.43330 WP_003104052.1.43356 WP_003104052.1.4348 WP_003104052.1.43593 WP_003104052.1.43603 WP_003104052.1.43662 WP_003104052.1.43667 WP_003104052.1.43673 WP_003104052.1.43729 WP_003104052.1.43756 WP_003104052.1.43783 WP_003104052.1.43802 WP_003104052.1.4381 WP_003104052.1.43811 WP_003104052.1.43826 WP_003104052.1.4397 WP_003104052.1.4398 WP_003104052.1.43998 WP_003104052.1.44046 WP_003104052.1.44094 WP_003104052.1.44213 WP_003104052.1.44260 WP_003104052.1.44373 WP_003104052.1.44434 WP_003104052.1.44486 WP_003104052.1.44563 WP_003104052.1.44565 WP_003104052.1.44581 WP_003104052.1.44725 WP_003104052.1.44739 WP_003104052.1.44760 WP_003104052.1.4493 WP_003104052.1.44959 WP_003104052.1.45063 WP_003104052.1.45090 WP_003104052.1.45146 WP_003104052.1.45199 WP_003104052.1.45202 WP_003104052.1.4522 WP_003104052.1.45228 WP_003104052.1.45298 WP_003104052.1.45306 WP_003104052.1.45312 WP_003104052.1.4532 WP_003104052.1.45328 WP_003104052.1.45353 WP_003104052.1.45358 WP_003104052.1.45464 WP_003104052.1.45478 WP_003104052.1.45485 WP_003104052.1.45604 WP_003104052.1.45635 WP_003104052.1.45678 WP_003104052.1.45700 WP_003104052.1.45711 WP_003104052.1.45723 WP_003104052.1.45818 WP_003104052.1.45837 WP_003104052.1.45920 WP_003104052.1.45934 WP_003104052.1.45961 WP_003104052.1.46032 WP_003104052.1.46093 WP_003104052.1.461 WP_003104052.1.46152 WP_003104052.1.46200 WP_003104052.1.46306 WP_003104052.1.46436 WP_003104052.1.46502 WP_003104052.1.46623 WP_003104052.1.46633 WP_003104052.1.46755 WP_003104052.1.46787 WP_003104052.1.46826 WP_003104052.1.46846 WP_003104052.1.46866 WP_003104052.1.46885 WP_003104052.1.46926 WP_003104052.1.46935 WP_003104052.1.47101 WP_003104052.1.47150 WP_003104052.1.47155 WP_003104052.1.47158 WP_003104052.1.47251 WP_003104052.1.4726 WP_003104052.1.47296 WP_003104052.1.47312 WP_003104052.1.47314 WP_003104052.1.47374 WP_003104052.1.47469 WP_003104052.1.47480 WP_003104052.1.47527 WP_003104052.1.47598 WP_003104052.1.47645 WP_003104052.1.47774 WP_003104052.1.47930 WP_003104052.1.47934 WP_003104052.1.47970 WP_003104052.1.48001 WP_003104052.1.48024 WP_003104052.1.48086 WP_003104052.1.48094 WP_003104052.1.48141 WP_003104052.1.48172 WP_003104052.1.48178 WP_003104052.1.48321 WP_003104052.1.48334 WP_003104052.1.4836 WP_003104052.1.48378 WP_003104052.1.48382 WP_003104052.1.48413 WP_003104052.1.48472 WP_003104052.1.48474 WP_003104052.1.48545 WP_003104052.1.48546 WP_003104052.1.48747 WP_003104052.1.48810 WP_003104052.1.48820 WP_003104052.1.48842 WP_003104052.1.48851 WP_003104052.1.48870 WP_003104052.1.48961 WP_003104052.1.49108 WP_003104052.1.4913 WP_003104052.1.49135 WP_003104052.1.49184 WP_003104052.1.49244 WP_003104052.1.49265 WP_003104052.1.49266 WP_003104052.1.49277 WP_003104052.1.49286 WP_003104052.1.49293 WP_003104052.1.49360 WP_003104052.1.49416 WP_003104052.1.49500 WP_003104052.1.49557 WP_003104052.1.49566 WP_003104052.1.49688 WP_003104052.1.49798 WP_003104052.1.49806 WP_003104052.1.49833 WP_003104052.1.49842 WP_003104052.1.49922 WP_003104052.1.49948 WP_003104052.1.49976 WP_003104052.1.49988 WP_003104052.1.49998 WP_003104052.1.50176 WP_003104052.1.50180 WP_003104052.1.50222 WP_003104052.1.50232 WP_003104052.1.50242 WP_003104052.1.5043 WP_003104052.1.50459 WP_003104052.1.50567 WP_003104052.1.50653 WP_003104052.1.50665 WP_003104052.1.50668 WP_003104052.1.50682 WP_003104052.1.50691 WP_003104052.1.50734 WP_003104052.1.50783 WP_003104052.1.50922 WP_003104052.1.50967 WP_003104052.1.50989 WP_003104052.1.51019 WP_003104052.1.51136 WP_003104052.1.51141 WP_003104052.1.51173 WP_003104052.1.51183 WP_003104052.1.51185 WP_003104052.1.51267 WP_003104052.1.5132 WP_003104052.1.51457 WP_003104052.1.51472 WP_003104052.1.51501 WP_003104052.1.51538 WP_003104052.1.51549 WP_003104052.1.51585 WP_003104052.1.51682 WP_003104052.1.51727 WP_003104052.1.51733 WP_003104052.1.51807 WP_003104052.1.51847 WP_003104052.1.51889 WP_003104052.1.51917 WP_003104052.1.51928 WP_003104052.1.51937 WP_003104052.1.51943 WP_003104052.1.51957 WP_003104052.1.51976 WP_003104052.1.52146 WP_003104052.1.52152 WP_003104052.1.52220 WP_003104052.1.52244 WP_003104052.1.5226 WP_003104052.1.52326 WP_003104052.1.52334 WP_003104052.1.5235 WP_003104052.1.52355 WP_003104052.1.52409 WP_003104052.1.52449 WP_003104052.1.52500 WP_003104052.1.52537 WP_003104052.1.5258 WP_003104052.1.52583 WP_003104052.1.5260 WP_003104052.1.52690 WP_003104052.1.52697 WP_003104052.1.52700 WP_003104052.1.52728 WP_003104052.1.52784 WP_003104052.1.52810 WP_003104052.1.52850 WP_003104052.1.5294 WP_003104052.1.53037 WP_003104052.1.53070 WP_003104052.1.53072 WP_003104052.1.53169 WP_003104052.1.53267 WP_003104052.1.53287 WP_003104052.1.53351 WP_003104052.1.53371 WP_003104052.1.53427 WP_003104052.1.53486 WP_003104052.1.53528 WP_003104052.1.53530 WP_003104052.1.53663 WP_003104052.1.53678 WP_003104052.1.53719 WP_003104052.1.53726 WP_003104052.1.53826 WP_003104052.1.5388 WP_003104052.1.53932 WP_003104052.1.53948 WP_003104052.1.53951 WP_003104052.1.5399 WP_003104052.1.54003 WP_003104052.1.54078 WP_003104052.1.54090 WP_003104052.1.54133 WP_003104052.1.54140 WP_003104052.1.54146 WP_003104052.1.5420 WP_003104052.1.54248 WP_003104052.1.5427 WP_003104052.1.54293 WP_003104052.1.54354 WP_003104052.1.54462 WP_003104052.1.54497 WP_003104052.1.54571 WP_003104052.1.54742 WP_003104052.1.54809 WP_003104052.1.54974 WP_003104052.1.55089 WP_003104052.1.55169 WP_003104052.1.55318 WP_003104052.1.55347 WP_003104052.1.55387 WP_003104052.1.55400 WP_003104052.1.55445 WP_003104052.1.55478 WP_003104052.1.55543 WP_003104052.1.55729 WP_003104052.1.55813 WP_003104052.1.55976 WP_003104052.1.56013 WP_003104052.1.56037 WP_003104052.1.56145 WP_003104052.1.56171 WP_003104052.1.56187 WP_003104052.1.56188 WP_003104052.1.56196 WP_003104052.1.56228 WP_003104052.1.56229 WP_003104052.1.56315 WP_003104052.1.56348 WP_003104052.1.56442 WP_003104052.1.56452 WP_003104052.1.56465 WP_003104052.1.56474 WP_003104052.1.56475 WP_003104052.1.56623 WP_003104052.1.56626 WP_003104052.1.56632 WP_003104052.1.56745 WP_003104052.1.56768 WP_003104052.1.56797 WP_003104052.1.56808 WP_003104052.1.56819 WP_003104052.1.56837 WP_003104052.1.56864 WP_003104052.1.56896 WP_003104052.1.56973 WP_003104052.1.57005 WP_003104052.1.57020 WP_003104052.1.57113 WP_003104052.1.57131 WP_003104052.1.57140 WP_003104052.1.57276 WP_003104052.1.5731 WP_003104052.1.57369 WP_003104052.1.57460 WP_003104052.1.57477 WP_003104052.1.57480 WP_003104052.1.57532 WP_003104052.1.57548 WP_003104052.1.57566 WP_003104052.1.57728 WP_003104052.1.57792 WP_003104052.1.57839 WP_003104052.1.57841 WP_003104052.1.57853 WP_003104052.1.57966 WP_003104052.1.58019 WP_003104052.1.58056 WP_003104052.1.58155 WP_003104052.1.58162 WP_003104052.1.58183 WP_003104052.1.58193 WP_003104052.1.58200 WP_003104052.1.58228 WP_003104052.1.58294 WP_003104052.1.58360 WP_003104052.1.58417 WP_003104052.1.58436 WP_003104052.1.58482 WP_003104052.1.5850 WP_003104052.1.58510 WP_003104052.1.58527 WP_003104052.1.58689 WP_003104052.1.5869 WP_003104052.1.58785 WP_003104052.1.58800 WP_003104052.1.5889 WP_003104052.1.58944 WP_003104052.1.58952 WP_003104052.1.59013 WP_003104052.1.59076 WP_003104052.1.59099 WP_003104052.1.59123 WP_003104052.1.59156 WP_003104052.1.59158 WP_003104052.1.59176 WP_003104052.1.59212 WP_003104052.1.59246 WP_003104052.1.59249 WP_003104052.1.59250 WP_003104052.1.59288 WP_003104052.1.5937 WP_003104052.1.59376 WP_003104052.1.594 WP_003104052.1.59469 WP_003104052.1.59563 WP_003104052.1.59688 WP_003104052.1.59724 WP_003104052.1.59759 WP_003104052.1.59797 WP_003104052.1.59831 WP_003104052.1.59870 WP_003104052.1.60051 WP_003104052.1.60079 WP_003104052.1.60082 WP_003104052.1.60084 WP_003104052.1.60085 WP_003104052.1.60206 WP_003104052.1.60261 WP_003104052.1.60347 WP_003104052.1.60364 WP_003104052.1.60396 WP_003104052.1.60415 WP_003104052.1.60467 WP_003104052.1.60472 WP_003104052.1.60509 WP_003104052.1.60600 WP_003104052.1.60602 WP_003104052.1.60603 WP_003104052.1.60639 WP_003104052.1.60679 WP_003104052.1.60686 WP_003104052.1.607 WP_003104052.1.60850 WP_003104052.1.60910 WP_003104052.1.60916 WP_003104052.1.60970 WP_003104052.1.60979 WP_003104052.1.61130 WP_003104052.1.61191 WP_003104052.1.61209 WP_003104052.1.61222 WP_003104052.1.61269 WP_003104052.1.61288 WP_003104052.1.61294 WP_003104052.1.61299 WP_003104052.1.6130 WP_003104052.1.61366 WP_003104052.1.61431 WP_003104052.1.61493 WP_003104052.1.61549 WP_003104052.1.61589 WP_003104052.1.61598 WP_003104052.1.61696 WP_003104052.1.6173 WP_003104052.1.61943 WP_003104052.1.62010 WP_003104052.1.62035 WP_003104052.1.62180 WP_003104052.1.62186 WP_003104052.1.62211 WP_003104052.1.62263 WP_003104052.1.62357 WP_003104052.1.62396 WP_003104052.1.62410 WP_003104052.1.6242 WP_003104052.1.62483 WP_003104052.1.62516 WP_003104052.1.62534 WP_003104052.1.626 WP_003104052.1.62604 WP_003104052.1.62635 WP_003104052.1.62688 WP_003104052.1.62701 WP_003104052.1.62703 WP_003104052.1.62704 WP_003104052.1.62716 WP_003104052.1.62768 WP_003104052.1.62772 WP_003104052.1.6280 WP_003104052.1.6283 WP_003104052.1.62834 WP_003104052.1.62838 WP_003104052.1.62873 WP_003104052.1.62917 WP_003104052.1.63038 WP_003104052.1.63041 WP_003104052.1.63057 WP_003104052.1.63124 WP_003104052.1.63193 WP_003104052.1.63196 WP_003104052.1.63338 WP_003104052.1.63369 WP_003104052.1.63401 WP_003104052.1.63591 WP_003104052.1.63597 WP_003104052.1.63634 WP_003104052.1.63659 WP_003104052.1.63739 WP_003104052.1.63784 WP_003104052.1.63995 WP_003104052.1.64139 WP_003104052.1.64155 WP_003104052.1.64198 WP_003104052.1.64212 WP_003104052.1.64309 WP_003104052.1.64329 WP_003104052.1.64340 WP_003104052.1.64433 WP_003104052.1.64544 WP_003104052.1.64591 WP_003104052.1.64603 WP_003104052.1.6461 WP_003104052.1.64726 WP_003104052.1.64748 WP_003104052.1.64799 WP_003104052.1.64807 WP_003104052.1.64854 WP_003104052.1.64862 WP_003104052.1.64880 WP_003104052.1.64885 WP_003104052.1.64886 WP_003104052.1.64983 WP_003104052.1.64984 WP_003104052.1.65066 WP_003104052.1.65092 WP_003104052.1.65095 WP_003104052.1.65099 WP_003104052.1.65145 WP_003104052.1.65196 WP_003104052.1.65197 WP_003104052.1.65227 WP_003104052.1.65237 WP_003104052.1.65247 WP_003104052.1.65285 WP_003104052.1.65304 WP_003104052.1.65312 WP_003104052.1.65316 WP_003104052.1.65334 WP_003104052.1.65335 WP_003104052.1.65457 WP_003104052.1.65549 WP_003104052.1.65588 WP_003104052.1.65632 WP_003104052.1.65642 WP_003104052.1.65679 WP_003104052.1.65740 WP_003104052.1.65819 WP_003104052.1.65867 WP_003104052.1.6589 WP_003104052.1.65926 WP_003104052.1.66062 WP_003104052.1.66155 WP_003104052.1.66165 WP_003104052.1.6627 WP_003104052.1.66277 WP_003104052.1.66345 WP_003104052.1.66348 WP_003104052.1.66364 WP_003104052.1.66410 WP_003104052.1.66526 WP_003104052.1.66563 WP_003104052.1.66634 WP_003104052.1.66721 WP_003104052.1.66892 WP_003104052.1.66929 WP_003104052.1.66931 WP_003104052.1.66945 WP_003104052.1.66950 WP_003104052.1.66982 WP_003104052.1.67010 WP_003104052.1.67188 WP_003104052.1.67192 WP_003104052.1.67205 WP_003104052.1.67261 WP_003104052.1.67269 WP_003104052.1.6734 WP_003104052.1.67370 WP_003104052.1.67388 WP_003104052.1.67472 WP_003104052.1.67489 WP_003104052.1.67506 WP_003104052.1.67526 WP_003104052.1.67531 WP_003104052.1.67545 WP_003104052.1.6768 WP_003104052.1.67686 WP_003104052.1.67755 WP_003104052.1.67830 WP_003104052.1.67875 WP_003104052.1.67899 WP_003104052.1.67903 WP_003104052.1.67937 WP_003104052.1.67948 WP_003104052.1.68000 WP_003104052.1.6808 WP_003104052.1.68158 WP_003104052.1.68162 WP_003104052.1.68172 WP_003104052.1.68183 WP_003104052.1.68194 WP_003104052.1.68252 WP_003104052.1.68317 WP_003104052.1.68472 WP_003104052.1.68499 WP_003104052.1.6850 WP_003104052.1.68561 WP_003104052.1.68568 WP_003104052.1.68638 WP_003104052.1.6866 WP_003104052.1.68756 WP_003104052.1.68781 WP_003104052.1.68790 WP_003104052.1.68800 WP_003104052.1.68802 WP_003104052.1.68850 WP_003104052.1.68857 WP_003104052.1.68862 WP_003104052.1.68881 WP_003104052.1.68910 WP_003104052.1.68938 WP_003104052.1.68979 WP_003104052.1.69088 WP_003104052.1.6911 WP_003104052.1.69159 WP_003104052.1.69209 WP_003104052.1.69260 WP_003104052.1.6928 WP_003104052.1.6931 WP_003104052.1.69330 WP_003104052.1.6937 WP_003104052.1.69534 WP_003104052.1.69556 WP_003104052.1.69599 WP_003104052.1.69702 WP_003104052.1.69788 WP_003104052.1.69791 WP_003104052.1.69819 WP_003104052.1.69834 WP_003104052.1.69907 WP_003104052.1.69993 WP_003104052.1.70092 WP_003104052.1.70098 WP_003104052.1.70138 WP_003104052.1.70168 WP_003104052.1.70194 WP_003104052.1.70216 WP_003104052.1.70229 WP_003104052.1.70331 WP_003104052.1.70460 WP_003104052.1.70470 WP_003104052.1.70537 WP_003104052.1.70561 WP_003104052.1.70583 WP_003104052.1.70648 WP_003104052.1.70670 WP_003104052.1.70677 WP_003104052.1.70693 WP_003104052.1.7077 WP_003104052.1.70778 WP_003104052.1.70831 WP_003104052.1.70991 WP_003104052.1.71038 WP_003104052.1.71141 WP_003104052.1.71203 WP_003104052.1.71234 WP_003104052.1.71249 WP_003104052.1.71254 WP_003104052.1.7128 WP_003104052.1.71346 WP_003104052.1.71385 WP_003104052.1.71412 WP_003104052.1.71570 WP_003104052.1.7163 WP_003104052.1.71642 WP_003104052.1.71666 WP_003104052.1.71738 WP_003104052.1.71799 WP_003104052.1.71806 WP_003104052.1.71822 WP_003104052.1.71862 WP_003104052.1.71866 WP_003104052.1.71891 WP_003104052.1.71927 WP_003104052.1.71934 WP_003104052.1.72149 WP_003104052.1.72167 WP_003104052.1.72181 WP_003104052.1.72183 WP_003104052.1.72287 WP_003104052.1.72323 WP_003104052.1.72331 WP_003104052.1.72346 WP_003104052.1.72378 WP_003104052.1.72447 WP_003104052.1.72458 WP_003104052.1.72477 WP_003104052.1.72541 WP_003104052.1.72562 WP_003104052.1.72570 WP_003104052.1.72653 WP_003104052.1.72669 WP_003104052.1.72727 WP_003104052.1.7276 WP_003104052.1.72768 WP_003104052.1.72772 WP_003104052.1.72845 WP_003104052.1.72920 WP_003104052.1.73048 WP_003104052.1.73135 WP_003104052.1.73149 WP_003104052.1.73172 WP_003104052.1.7327 WP_003104052.1.7329 WP_003104052.1.733 WP_003104052.1.73455 WP_003104052.1.73523 WP_003104052.1.73541 WP_003104052.1.73601 WP_003104052.1.73651 WP_003104052.1.73728 WP_003104052.1.7377 WP_003104052.1.7382 WP_003104052.1.73860 WP_003104052.1.73889 WP_003104052.1.73911 WP_003104052.1.73941 WP_003104052.1.74 WP_003104052.1.74000 WP_003104052.1.74072 WP_003104052.1.74074 WP_003104052.1.7408 WP_003104052.1.74106 WP_003104052.1.74167 WP_003104052.1.74175 WP_003104052.1.74180 WP_003104052.1.74219 WP_003104052.1.74264 WP_003104052.1.74268 WP_003104052.1.74281 WP_003104052.1.74287 WP_003104052.1.74326 WP_003104052.1.7445 WP_003104052.1.74458 WP_003104052.1.74473 WP_003104052.1.74475 WP_003104052.1.7448 WP_003104052.1.74518 WP_003104052.1.7456 WP_003104052.1.74568 WP_003104052.1.74604 WP_003104052.1.74629 WP_003104052.1.74637 WP_003104052.1.74685 WP_003104052.1.74772 WP_003104052.1.74776 WP_003104052.1.748 WP_003104052.1.74878 WP_003104052.1.74941 WP_003104052.1.74948 WP_003104052.1.75041 WP_003104052.1.75204 WP_003104052.1.75277 WP_003104052.1.75303 WP_003104052.1.75431 WP_003104052.1.7547 WP_003104052.1.75549 WP_003104052.1.75573 WP_003104052.1.75580 WP_003104052.1.75599 WP_003104052.1.75603 WP_003104052.1.75631 WP_003104052.1.75771 WP_003104052.1.75792 WP_003104052.1.75825 WP_003104052.1.75826 WP_003104052.1.75860 WP_003104052.1.75935 WP_003104052.1.75938 WP_003104052.1.75947 WP_003104052.1.7595 WP_003104052.1.76077 WP_003104052.1.76092 WP_003104052.1.76141 WP_003104052.1.76145 WP_003104052.1.76192 WP_003104052.1.76322 WP_003104052.1.76355 WP_003104052.1.76383 WP_003104052.1.76399 WP_003104052.1.76441 WP_003104052.1.76467 WP_003104052.1.76484 WP_003104052.1.76543 WP_003104052.1.76600 WP_003104052.1.76633 WP_003104052.1.7666 WP_003104052.1.76716 WP_003104052.1.76775 WP_003104052.1.76791 WP_003104052.1.76861 WP_003104052.1.76922 WP_003104052.1.76985 WP_003104052.1.77235 WP_003104052.1.77286 WP_003104052.1.77317 WP_003104052.1.77476 WP_003104052.1.77490 WP_003104052.1.77566 WP_003104052.1.77574 WP_003104052.1.77587 WP_003104052.1.77686 WP_003104052.1.77750 WP_003104052.1.77769 WP_003104052.1.7779 WP_003104052.1.77819 WP_003104052.1.77834 WP_003104052.1.77913 WP_003104052.1.78104 WP_003104052.1.78112 WP_003104052.1.78118 WP_003104052.1.78134 WP_003104052.1.78158 WP_003104052.1.78280 WP_003104052.1.78288 WP_003104052.1.78380 WP_003104052.1.7840 WP_003104052.1.78409 WP_003104052.1.78425 WP_003104052.1.78430 WP_003104052.1.78437 WP_003104052.1.78570 WP_003104052.1.78623 WP_003104052.1.78669 WP_003104052.1.78693 WP_003104052.1.78795 WP_003104052.1.788 WP_003104052.1.78810 WP_003104052.1.78926 WP_003104052.1.78947 WP_003104052.1.78954 WP_003104052.1.78986 WP_003104052.1.7899 WP_003104052.1.79007 WP_003104052.1.79177 WP_003104052.1.79193 WP_003104052.1.79256 WP_003104052.1.79286 WP_003104052.1.79311 WP_003104052.1.79357 WP_003104052.1.79364 WP_003104052.1.79429 WP_003104052.1.79431 WP_003104052.1.7945 WP_003104052.1.79463 WP_003104052.1.79507 WP_003104052.1.7953 WP_003104052.1.79544 WP_003104052.1.79569 WP_003104052.1.79601 WP_003104052.1.79631 WP_003104052.1.79699 WP_003104052.1.79754 WP_003104052.1.79788 WP_003104052.1.79862 WP_003104052.1.79883 WP_003104052.1.799 WP_003104052.1.79908 WP_003104052.1.79986 WP_003104052.1.8 WP_003104052.1.80033 WP_003104052.1.80068 WP_003104052.1.80102 WP_003104052.1.8013 WP_003104052.1.80174 WP_003104052.1.8028 WP_003104052.1.80306 WP_003104052.1.8038 WP_003104052.1.80410 WP_003104052.1.80411 WP_003104052.1.80481 WP_003104052.1.8051 WP_003104052.1.80535 WP_003104052.1.80572 WP_003104052.1.80627 WP_003104052.1.80632 WP_003104052.1.8064 WP_003104052.1.80645 WP_003104052.1.80683 WP_003104052.1.80720 WP_003104052.1.80785 WP_003104052.1.80846 WP_003104052.1.80880 WP_003104052.1.80892 WP_003104052.1.80910 WP_003104052.1.80929 WP_003104052.1.80931 WP_003104052.1.80938 WP_003104052.1.80969 WP_003104052.1.81082 WP_003104052.1.8110 WP_003104052.1.81206 WP_003104052.1.81237 WP_003104052.1.81331 WP_003104052.1.81368 WP_003104052.1.81426 WP_003104052.1.81470 WP_003104052.1.81482 WP_003104052.1.81487 WP_003104052.1.81581 WP_003104052.1.81591 WP_003104052.1.81622 WP_003104052.1.81643 WP_003104052.1.81708 WP_003104052.1.81728 WP_003104052.1.81742 WP_003104052.1.81748 WP_003104052.1.81771 WP_003104052.1.81784 WP_003104052.1.81802 WP_003104052.1.81834 WP_003104052.1.81844 WP_003104052.1.81856 WP_003104052.1.81874 WP_003104052.1.81927 WP_003104052.1.81950 WP_003104052.1.81957 WP_003104052.1.81960 WP_003104052.1.81986 WP_003104052.1.82117 WP_003104052.1.82127 WP_003104052.1.82178 WP_003104052.1.82260 WP_003104052.1.8227 WP_003104052.1.82310 WP_003104052.1.82312 WP_003104052.1.82328 WP_003104052.1.82334 WP_003104052.1.8238 WP_003104052.1.82442 WP_003104052.1.82487 WP_003104052.1.82580 WP_003104052.1.82604 WP_003104052.1.82606 WP_003104052.1.82620 WP_003104052.1.82643 WP_003104052.1.82686 WP_003104052.1.82710 WP_003104052.1.8284 WP_003104052.1.82864 WP_003104052.1.82882 WP_003104052.1.82887 WP_003104052.1.82936 WP_003104052.1.83025 WP_003104052.1.83131 WP_003104052.1.83184 WP_003104052.1.83213 WP_003104052.1.83251 WP_003104052.1.83267 WP_003104052.1.83296 WP_003104052.1.83374 WP_003104052.1.83394 WP_003104052.1.83440 WP_003104052.1.83460 WP_003104052.1.83463 WP_003104052.1.835 WP_003104052.1.83503 WP_003104052.1.8353 WP_003104052.1.83534 WP_003104052.1.83540 WP_003104052.1.8357 WP_003104052.1.83637 WP_003104052.1.83673 WP_003104052.1.83698 WP_003104052.1.83715 WP_003104052.1.83946 WP_003104052.1.84003 WP_003104052.1.84008 WP_003104052.1.84162 WP_003104052.1.84174 WP_003104052.1.84177 WP_003104052.1.84178 WP_003104052.1.84190 WP_003104052.1.84203 WP_003104052.1.84271 WP_003104052.1.84297 WP_003104052.1.8437 WP_003104052.1.84374 WP_003104052.1.84398 WP_003104052.1.84404 WP_003104052.1.84439 WP_003104052.1.84471 WP_003104052.1.84487 WP_003104052.1.84526 WP_003104052.1.8453 WP_003104052.1.84538 WP_003104052.1.84558 WP_003104052.1.84589 WP_003104052.1.84674 WP_003104052.1.84684 WP_003104052.1.84702 WP_003104052.1.84715 WP_003104052.1.84754 WP_003104052.1.84792 WP_003104052.1.8484 WP_003104052.1.84865 WP_003104052.1.84937 WP_003104052.1.84946 WP_003104052.1.8498 WP_003104052.1.85018 WP_003104052.1.85028 WP_003104052.1.85059 WP_003104052.1.85150 WP_003104052.1.85220 WP_003104052.1.85290 WP_003104052.1.85298 WP_003104052.1.85303 WP_003104052.1.85311 WP_003104052.1.85318 WP_003104052.1.85357 WP_003104052.1.85446 WP_003104052.1.85453 WP_003104052.1.85574 WP_003104052.1.85633 WP_003104052.1.85638 WP_003104052.1.85788 WP_003104052.1.85897 WP_003104052.1.85910 WP_003104052.1.85920 WP_003104052.1.86002 WP_003104052.1.86047 WP_003104052.1.86055 WP_003104052.1.86058 WP_003104052.1.861 WP_003104052.1.86125 WP_003104052.1.86182 WP_003104052.1.86278 WP_003104052.1.86287 WP_003104052.1.86293 WP_003104052.1.86386 WP_003104052.1.86432 WP_003104052.1.865 WP_003104052.1.86545 WP_003104052.1.86552 WP_003104052.1.86554 WP_003104052.1.86652 WP_003104052.1.86665 WP_003104052.1.867 WP_003104052.1.86708 WP_003104052.1.86733 WP_003104052.1.86774 WP_003104052.1.86780 WP_003104052.1.86785 WP_003104052.1.86796 WP_003104052.1.86822 WP_003104052.1.8693 WP_003104052.1.86947 WP_003104052.1.86970 WP_003104052.1.86985 WP_003104052.1.87104 WP_003104052.1.87163 WP_003104052.1.8718 WP_003104052.1.87182 WP_003104052.1.87183 WP_003104052.1.87316 WP_003104052.1.87390 WP_003104052.1.87435 WP_003104052.1.87463 WP_003104052.1.8749 WP_003104052.1.87530 WP_003104052.1.87547 WP_003104052.1.87648 WP_003104052.1.87763 WP_003104052.1.8785 WP_003104052.1.87877 WP_003104052.1.87888 WP_003104052.1.87970 WP_003104052.1.87981 WP_003104052.1.87987 WP_003104052.1.88004 WP_003104052.1.88308 WP_003104052.1.88330 WP_003104052.1.88360 WP_003104052.1.88388 WP_003104052.1.88415 WP_003104052.1.88517 WP_003104052.1.8852 WP_003104052.1.88540 WP_003104052.1.88550 WP_003104052.1.88578 WP_003104052.1.88605 WP_003104052.1.88659 WP_003104052.1.88679 WP_003104052.1.88680 WP_003104052.1.88714 WP_003104052.1.88750 WP_003104052.1.88796 WP_003104052.1.889 WP_003104052.1.88900 WP_003104052.1.88949 WP_003104052.1.88969 WP_003104052.1.89083 WP_003104052.1.89098 WP_003104052.1.8911 WP_003104052.1.89234 WP_003104052.1.89245 WP_003104052.1.89266 WP_003104052.1.89276 WP_003104052.1.89330 WP_003104052.1.89409 WP_003104052.1.89434 WP_003104052.1.89440 WP_003104052.1.89480 WP_003104052.1.8949 WP_003104052.1.89491 WP_003104052.1.89523 WP_003104052.1.89577 WP_003104052.1.89610 WP_003104052.1.89638 WP_003104052.1.89662 WP_003104052.1.89669 WP_003104052.1.89736 WP_003104052.1.8976 WP_003104052.1.89776 WP_003104052.1.89805 WP_003104052.1.89866 WP_003104052.1.89867 WP_003104052.1.89868 WP_003104052.1.89871 WP_003104052.1.89886 WP_003104052.1.89992 WP_003104052.1.90024 WP_003104052.1.90032 WP_003104052.1.90056 WP_003104052.1.90110 WP_003104052.1.90141 WP_003104052.1.90150 WP_003104052.1.90189 WP_003104052.1.90224 WP_003104052.1.90225 WP_003104052.1.90242 WP_003104052.1.90268 WP_003104052.1.90306 WP_003104052.1.90412 WP_003104052.1.9056 WP_003104052.1.90569 WP_003104052.1.90655 WP_003104052.1.90770 WP_003104052.1.90940 WP_003104052.1.90999 WP_003104052.1.91093 WP_003104052.1.91161 WP_003104052.1.9120 WP_003104052.1.91204 WP_003104052.1.91281 WP_003104052.1.91307 WP_003104052.1.91336 WP_003104052.1.91360 WP_003104052.1.91392 WP_003104052.1.91416 WP_003104052.1.9143 WP_003104052.1.91431 WP_003104052.1.91438 WP_003104052.1.91467 WP_003104052.1.91527 WP_003104052.1.91563 WP_003104052.1.91585 WP_003104052.1.91796 WP_003104052.1.91803 WP_003104052.1.9182 WP_003104052.1.91838 WP_003104052.1.91846 WP_003104052.1.91860 WP_003104052.1.91862 WP_003104052.1.9191 WP_003104052.1.91938 WP_003104052.1.91943 WP_003104052.1.91996 WP_003104052.1.92043 WP_003104052.1.92175 WP_003104052.1.9219 WP_003104052.1.92314 WP_003104052.1.92321 WP_003104052.1.92357 WP_003104052.1.92454 WP_003104052.1.92573 WP_003104052.1.92585 WP_003104052.1.92587 WP_003104052.1.92589 WP_003104052.1.92624 WP_003104052.1.92630 WP_003104052.1.92642 WP_003104052.1.9272 WP_003104052.1.92759 WP_003104052.1.92769 WP_003104052.1.92839 WP_003104052.1.92847 WP_003104052.1.92894 WP_003104052.1.92924 WP_003104052.1.92930 WP_003104052.1.93001 WP_003104052.1.93090 WP_003104052.1.93122 WP_003104052.1.93130 WP_003104052.1.93144 WP_003104052.1.93148 WP_003104052.1.93250 WP_003104052.1.93264 WP_003104052.1.9328 WP_003104052.1.93446 WP_003104052.1.9349 WP_003104052.1.93493 WP_003104052.1.93498 WP_003104052.1.93547 WP_003104052.1.93562 WP_003104052.1.93568 WP_003104052.1.93797 WP_003104052.1.93848 WP_003104052.1.93889 WP_003104052.1.93897 WP_003104052.1.94004 WP_003104052.1.94031 WP_003104052.1.94065 WP_003104052.1.94078 WP_003104052.1.94136 WP_003104052.1.94174 WP_003104052.1.94211 WP_003104052.1.94218 WP_003104052.1.94221 WP_003104052.1.94230 WP_003104052.1.94243 WP_003104052.1.94285 WP_003104052.1.94333 WP_003104052.1.94349 WP_003104052.1.94385 WP_003104052.1.94434 WP_003104052.1.9444 WP_003104052.1.94450 WP_003104052.1.94682 WP_003104052.1.94742 WP_003104052.1.94814 WP_003104052.1.94818 WP_003104052.1.94856 WP_003104052.1.94874 WP_003104052.1.94896 WP_003104052.1.94897 WP_003104052.1.94943 WP_003104052.1.95018 WP_003104052.1.95025 WP_003104052.1.95027 WP_003104052.1.95056 WP_003104052.1.95117 WP_003104052.1.95132 WP_003104052.1.95187 WP_003104052.1.95207 WP_003104052.1.95217 WP_003104052.1.95305 WP_003104052.1.95324 WP_003104052.1.95354 WP_003104052.1.95359 WP_003104052.1.95460 WP_003104052.1.95488 WP_003104052.1.95525 WP_003104052.1.95536 WP_003104052.1.95638 WP_003104052.1.95668 WP_003104052.1.95774 WP_003104052.1.95782 WP_003104052.1.95787 WP_003104052.1.95802 WP_003104052.1.95820 WP_003104052.1.95825 WP_003104052.1.95959 WP_003104052.1.9599 WP_003104052.1.95994 WP_003104052.1.95999 WP_003104052.1.96008 WP_003104052.1.9604 WP_003104052.1.96058 WP_003104052.1.961 WP_003104052.1.96134 WP_003104052.1.96193 WP_003104052.1.96243 WP_003104052.1.96267 WP_003104052.1.96357 WP_003104052.1.96384 WP_003104052.1.96434 WP_003104052.1.96452 WP_003104052.1.96506 WP_003104052.1.96667 WP_003104052.1.96702 WP_003104052.1.96714 WP_003104052.1.96880 WP_003104052.1.96967 WP_003104052.1.9706 WP_003104052.1.97118 WP_003104052.1.97126 WP_003104052.1.97204 WP_003104052.1.97213 WP_003104052.1.9722 WP_003104052.1.97271 WP_003104052.1.97272 WP_003104052.1.97377 WP_003104052.1.97474 WP_003104052.1.97488 WP_003104052.1.97521 WP_003104052.1.97583 WP_003104052.1.97614 WP_003104052.1.977 WP_003104052.1.97826 WP_003104052.1.97877 WP_003104052.1.97968 WP_003104052.1.98111 WP_003104052.1.98260 WP_003104052.1.98276 WP_003104052.1.98308 WP_003104052.1.98410 WP_003104052.1.98414 WP_003104052.1.98433 WP_003104052.1.9845 WP_003104052.1.985 WP_003104052.1.98515 WP_003104052.1.98522 WP_003104052.1.98573 WP_003104052.1.98600 WP_003104052.1.98610 WP_003104052.1.98678 WP_003104052.1.98693 WP_003104052.1.98718 WP_003104052.1.98788 WP_003104052.1.98814 WP_003104052.1.9885 WP_003104052.1.98873 WP_003104052.1.98907 WP_003104052.1.98926 WP_003104052.1.98958 WP_003104052.1.98960 WP_003104052.1.98963 WP_003104052.1.99065 WP_003104052.1.99068 WP_003104052.1.99103 WP_003104052.1.99214 WP_003104052.1.99293 WP_003104052.1.99353 WP_003104052.1.99378 WP_003104052.1.99386 WP_003104052.1.99389 WP_003104052.1.99443 WP_003104052.1.99461 WP_003104052.1.9951 WP_003104052.1.99516 WP_003104052.1.99647 WP_003104052.1.99654 WP_003104052.1.99662 WP_003104052.1.99746 WP_003104052.1.99757 WP_003104052.1.99772 WP_003104052.1.99795 WP_003104052.1.99835 WP_003104052.1.9989 WP_003104052.1.99930 gi|478478373|ref|YP_007709024.1| gi|568309167|ref|YP_008981436.1| gi|514410076|ref|YP_008133419.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]