SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC61925 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC61925
Domain Number 1 Region: 391-483
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000196
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC61925
Sequence length 484
Comment $ MCSG $ SQ172741 $ PDBT83683 $
Sequence
MFQQIYQEWFSNIRADVLAGLVVGLALIPEAIAFSIIAGVDPQVGLYASFSMAVVIAFMG
GRPAMISAATGAMALVMVSLVKEHGLNYLFAATILTGIIQIIAGQLKLAKLMRFVSKSVV
IGFVNALAILIFMAQLPELIHVSGQVYLFVALGLAIIYLFPYIPRIGKLIPSPMVCIITI
TFLALIFSANVRTVGDMGHLPNTLPHFFVPDIPWNLETLWIILPYSSALAAVGLLESMMT
ATIVDELTNTSSNKHRECKGQGIANIVTGFMGGMAGCAMIGQSMINVKSGARARLSTFVA
GVFLLILVVFISDWLKVIPMAALVAVMIMVSISTFDWGSIKNFRRNPKSSNIVMLTTVVV
VVATHNLAIGVLVGVLLSALFLAQKLENDVRVETTLHQNTRIYDVRGQLFFSSSERFAKA
FDFQENVAHVIIDLTHSHIWDVTTVASLDHIVDKFQKNGIQVTVKGLNEASSIMIEQYGT
HSKI
Download sequence
Identical sequences A0A2D7VFQ3 Q6FCU3
62977.ACIAD1241 gi|50084428|ref|YP_045938.1| WP_004926000.1.43955 WP_004926000.1.60904 WP_004926000.1.84452 WP_004926000.1.9579 WP_004926000.1.98780 APC61925

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]