SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC62042 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC62042
Domain Number 1 Region: 165-271
Classification Level Classification E-value
Superfamily SpoIIaa-like 7.26e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) APC62042
Sequence length 282
Comment $ MCSG $ SQ173009 $ PDBT83976 $
Sequence
MAKNKKLFEYLSQHAETISSTWYETIEETDPNSIYASTDPVVIHNLKSQNLAFNYKINRI
FIDDEDVYLPILKEWAFEVTQDQEHLKTPIHYIIREFVRVRDLYVSYVKEFVHLNQNTVK
SEEAEDLYHALIKAFDLVIHIFIEEMYKNTSLQLQAQKDMITELSAPVIVLFHSVGLLPL
IGDIDTVRAKLIMENTLHQCAKKKVTQLYIDLSGVAVIDTMVAHQLFSLIEALRLIGVSS
TLSGIRPEIAQTAVQLGLSFEGISLRSTLASAIASDLKLKKV
Download sequence
Identical sequences A0A125UIL9 A0A164XYY7 A0A1B2AWX9 G4EUZ2 L8AKP5 O31856
224308.BSU19450 gi|402776195|ref|YP_006630139.1| gi|470162138|ref|YP_007533913.1| gi|16079005|ref|NP_389827.1| gi|560129061|ref|YP_008830202.1| NP_389827.1.22788 WP_003231216.1.101301 WP_003231216.1.11257 WP_003231216.1.1140 WP_003231216.1.12759 WP_003231216.1.15902 WP_003231216.1.16291 WP_003231216.1.19261 WP_003231216.1.25531 WP_003231216.1.27372 WP_003231216.1.2914 WP_003231216.1.32219 WP_003231216.1.33846 WP_003231216.1.34621 WP_003231216.1.36189 WP_003231216.1.39605 WP_003231216.1.40859 WP_003231216.1.44140 WP_003231216.1.44184 WP_003231216.1.45019 WP_003231216.1.47157 WP_003231216.1.56274 WP_003231216.1.56411 WP_003231216.1.57184 WP_003231216.1.57201 WP_003231216.1.5726 WP_003231216.1.57513 WP_003231216.1.6139 WP_003231216.1.6517 WP_003231216.1.65223 WP_003231216.1.72999 WP_003231216.1.76977 WP_003231216.1.78686 WP_003231216.1.78811 WP_003231216.1.81116 WP_003231216.1.81747 WP_003231216.1.82722 WP_003231216.1.88042 WP_003231216.1.91723 WP_003231216.1.93420 WP_003231216.1.94199 WP_003231216.1.96043 WP_003231216.1.979 APC62042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]