SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC62042.3 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC62042.3
Domain Number 1 Region: 3-92
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.1e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC62042.3
Sequence length 94
Comment $ MCSG $ SQ173012 $ PDBT83979 $
Sequence
PVIVLFHSVGLLPLIGDIDTVRAKLIMENTLHQCAKKKVTQLYIDLSGVAVIDTMVAHQL
FSLIEALRLIGVSSTLSGIRPEIAQTAVQLGLSF
Download sequence
Identical sequences APC62042.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]