SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC62044 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC62044
Domain Number 1 Region: 5-115
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.47e-20
Family Anti-sigma factor antagonist SpoIIaa 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) APC62044
Sequence length 121
Comment $ MCSG $ SQ173017 $ PDBT83984 $
Sequence
MRHPKIPILKLYNCLLVSIQWELDDQTALTFQEDLLNKIYETGANGVVIDLTSVDMIDSF
IAKVLGDVITMSKLMGAKVVLTGIQPAVAVTLIELGIALEEIETALDLEQGLETLKRELG
E
Download sequence
Identical sequences A0A063XHI7 A0A0K6K5I8 A0A0M0KVS1 A0A0T8Q253 A0A125UED5 A0A132BMX6 A0A199WB77 A0A1J5X6V2 A0A1Q9FGN6 A0A1V4FTX3 A0A292GPD3 A0A2A2VUE2 D4G5E6 E0U3R3 G4NW55 I0F0M4 L8ACR7 L8PW30 P42410 U1Z2X0
gi|305673182|ref|YP_003864854.1| 224308.BSU04680 gi|560127495|ref|YP_008828636.1| gi|384174139|ref|YP_005555524.1| gi|350264720|ref|YP_004876027.1| APC62044 gi|402774712|ref|YP_006628656.1| gi|470160624|ref|YP_007532399.1| gi|386757070|ref|YP_006230286.1| gi|16077535|ref|NP_388349.1| gi|430756893|ref|YP_007210789.1| NP_388349.1.22788 WP_003225190.1.100042 WP_003225190.1.101301 WP_003225190.1.101446 WP_003225190.1.11088 WP_003225190.1.11231 WP_003225190.1.11257 WP_003225190.1.1140 WP_003225190.1.11581 WP_003225190.1.12644 WP_003225190.1.12759 WP_003225190.1.1358 WP_003225190.1.14761 WP_003225190.1.15902 WP_003225190.1.16291 WP_003225190.1.17079 WP_003225190.1.1831 WP_003225190.1.18944 WP_003225190.1.19261 WP_003225190.1.20099 WP_003225190.1.20502 WP_003225190.1.21045 WP_003225190.1.22408 WP_003225190.1.23108 WP_003225190.1.2546 WP_003225190.1.25531 WP_003225190.1.27155 WP_003225190.1.27371 WP_003225190.1.27372 WP_003225190.1.27612 WP_003225190.1.27660 WP_003225190.1.2914 WP_003225190.1.30885 WP_003225190.1.31028 WP_003225190.1.31100 WP_003225190.1.31260 WP_003225190.1.31786 WP_003225190.1.32001 WP_003225190.1.32025 WP_003225190.1.32219 WP_003225190.1.32420 WP_003225190.1.32693 WP_003225190.1.33083 WP_003225190.1.3320 WP_003225190.1.33285 WP_003225190.1.33846 WP_003225190.1.34322 WP_003225190.1.34621 WP_003225190.1.34750 WP_003225190.1.35833 WP_003225190.1.35907 WP_003225190.1.36189 WP_003225190.1.37074 WP_003225190.1.3747 WP_003225190.1.39562 WP_003225190.1.39605 WP_003225190.1.40844 WP_003225190.1.40859 WP_003225190.1.42368 WP_003225190.1.42762 WP_003225190.1.44140 WP_003225190.1.44184 WP_003225190.1.45019 WP_003225190.1.47157 WP_003225190.1.47672 WP_003225190.1.48147 WP_003225190.1.50592 WP_003225190.1.51783 WP_003225190.1.5262 WP_003225190.1.52847 WP_003225190.1.54596 WP_003225190.1.54948 WP_003225190.1.54949 WP_003225190.1.55792 WP_003225190.1.56085 WP_003225190.1.56274 WP_003225190.1.56411 WP_003225190.1.57156 WP_003225190.1.57201 WP_003225190.1.5726 WP_003225190.1.57513 WP_003225190.1.59841 WP_003225190.1.6139 WP_003225190.1.62713 WP_003225190.1.63795 WP_003225190.1.64557 WP_003225190.1.64889 WP_003225190.1.6517 WP_003225190.1.65188 WP_003225190.1.65223 WP_003225190.1.65841 WP_003225190.1.67028 WP_003225190.1.67974 WP_003225190.1.69439 WP_003225190.1.71361 WP_003225190.1.71402 WP_003225190.1.7159 WP_003225190.1.71834 WP_003225190.1.7186 WP_003225190.1.71916 WP_003225190.1.7204 WP_003225190.1.72152 WP_003225190.1.72516 WP_003225190.1.72999 WP_003225190.1.76814 WP_003225190.1.76977 WP_003225190.1.77994 WP_003225190.1.78686 WP_003225190.1.78811 WP_003225190.1.79046 WP_003225190.1.79288 WP_003225190.1.79633 WP_003225190.1.79712 WP_003225190.1.80832 WP_003225190.1.81116 WP_003225190.1.81747 WP_003225190.1.82722 WP_003225190.1.82789 WP_003225190.1.83369 WP_003225190.1.84183 WP_003225190.1.84434 WP_003225190.1.84556 WP_003225190.1.87192 WP_003225190.1.87300 WP_003225190.1.88042 WP_003225190.1.88382 WP_003225190.1.88591 WP_003225190.1.89000 WP_003225190.1.89821 WP_003225190.1.90368 WP_003225190.1.90830 WP_003225190.1.91060 WP_003225190.1.91133 WP_003225190.1.91225 WP_003225190.1.9164 WP_003225190.1.91723 WP_003225190.1.93400 WP_003225190.1.93420 WP_003225190.1.93618 WP_003225190.1.94199 WP_003225190.1.95009 WP_003225190.1.95507 WP_003225190.1.96043 WP_003225190.1.979 WP_003225190.1.99091 WP_003225190.1.99399 gi|472328976|ref|YP_007661252.1| gi|428277920|ref|YP_005559655.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]