SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for APC62721 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC62721
Domain Number 1 Region: 90-297
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.55e-39
Family Phosphate binding protein-like 0.0052
Further Details:      
 
Domain Number 2 Region: 4-112
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.35e-19
Family LysR-like transcriptional regulators 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC62721
Sequence length 313
Comment $ MCSG $ SQ174556 $ PDBT85766 $
Sequence
MDKFKTIALFMSTIETGSFSATAKKHATDPSTVSKAIKRLEEQLGLQLLYRSTRQLSLTS
AGQKYADTVGSLYQQLESCEHELKSANNSYSGALKINLPVSYGRVYMLPMLSRFKKAYPD
IELEVSFNDQYVDMISDAVDVSIRSGTLNDSRLVAQKLSPMAFVICASSDLLATRKVDIS
NEGLVALPWVLFRFKQTGKTMPINFSYQGCHIDIEPKKVTIVDDGETMAQMCAEGLGLSL
MPHFNAKALVVAGKMKVVAILDEFPSSGVFIVYPKRKDLPRRTQVFIEFVKDYLKEIGET
PSKTWLDTSINSS
Download sequence
Identical sequences Q487M1
WP_011041838.1.15195 gi|71278967|ref|YP_267744.1| 402671 APC62721 167879.CPS_0995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]