SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC62826 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC62826
Domain Number 1 Region: 159-269
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.71e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) APC62826
Sequence length 286
Comment $ MCSG $ SQ174792 $ PDBT86013 $
Sequence
MKNESIKIFQKKKQVILEKWITIQSQDQGLNNDLITNEDLRVQSEELLYTFIDNLTDNNI
ENPDSRDFENVLDILSSISISRAKQGYSPRETGFYVYSLKEALLSVLNEEIKDSSVLYTQ
SMAINKLLDSFTISTFETFIKGREDVIFRQTDEITQISTPVIRVWDGILALPIIGTLDSS
RTQVVMESLLQEIVDTGSSIAILDISGVPAVDSLVAQHLIKTVSATRLMGAECIISGIRP
EIAQTVVHLGIDLSTIITKATLASALKTAFVMLNLEVNKKQRNKTV
Download sequence
Identical sequences Q11VS4
APC62826 gi|110637625|ref|YP_677832.1| WP_011584607.1.19587 WP_011584607.1.79486 269798.CHU_1219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]