SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC63694 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC63694
Domain Number 1 Region: 396-485
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000746
Family Anti-sigma factor antagonist SpoIIaa 0.0099
Further Details:      
 
Weak hits

Sequence:  APC63694
Domain Number - Region: 352-395
Classification Level Classification E-value
Superfamily PRTase-like 0.0435
Family Phosphoribosyltransferases (PRTases) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) APC63694
Sequence length 496
Comment $ MCSG $ SQ176806 $ PDBT88174 $
Sequence
MISLTTYRQEWLGNLRGDLLSGIVVALALIPEAIAFSIIAGVDPKVGLYASFSIAVITAI
AGGRPGMISAATAATAVLMVTLVRDHGLEYLLAATVLAGLIQTSAGFLRLGFVMRYVSRS
VMTGFVNALAILIFLAQLPELDPRTVPPLTYLLVAGGLAIIYLFPRITRAVPSPLVTIVV
LTALTFALGLDVRTVGDMGALPDTLPMFLIPDIPLTFETLQIILPYSIAVAVVGLLESLM
TQNIVDDLTDTRSNRNQECIGQGLANTATGFIGGMAGCAMIGQSIINVKSGGRGRLSSFA
AGVYLLFMVVVLGDLVSRIPMAALVAIMIMVSIGTFSWSSVKSLRTHPRSSSVVMLATVA
TVVWTHNLAIGVLVGVLLSGIFFAAKIAQLFGVTSELSKDGRERIYRVEGQLFYASVEDF
MAAFDFREALDRVVIDVSRAHIWDISSVQALDMAVLKFRREGAEVRIVGMNEASETMVDR
LAIHDKPGAMDRLVAH
Download sequence
Identical sequences Q3IUY6
gi|77404817|ref|YP_345389.1| APC63694 gi|499650721|ref|WP_011331455.1|NZ_AKVW01000006 gi|77404817|ref|YP_345389.1|NC_007490 WP_011331455.1.22285 WP_011331455.1.62547 WP_011331455.1.80699 WP_011331455.1.8565 YP_345389.1.90827 272943.RSP_4197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]