SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for APC64150.2 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC64150.2
Domain Number 1 Region: 13-106
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 0.0000000353
Family D-glucarate dehydratase-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) APC64150.2
Sequence length 106
Comment $ MCSG $ SQ177910 $ PDBT89367 $
Sequence
PIAVQSMTNTRTTDVAATVAQIKSLEKVGADIVRVSVPTMEAAEAFKLIKQQVSVPLVAD
IHFDYRIALKVAEYGVDCLRINPGNIGNEARIRSVVDCARDKGIPI
Download sequence
Identical sequences APC64150.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]