SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC64212 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC64212
Domain Number 1 Region: 404-484
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000883
Family Anti-sigma factor antagonist SpoIIaa 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC64212
Sequence length 495
Comment $ MCSG $ SQ178050 $ PDBT89514 $
Sequence
MFKNFKIDWMSNIRGDLLAGIVVALALIPEAIAFSIIAGVDPKVGLYASFSISVVIAFAG
GRSGMISAATGAMALLMVTLVKEHGLEYLLAATVLTGVFQILAGYLKLGSLMRFVSRSVV
TGFVNALAILIFMAQLPELTDVTWHVYAMTVAGLGIIYLFPYLPVIGKLIPSPLVCIIAL
TIISIWFGIDVRTVGDMGHLPDTLPIFLWPDVPLNLNTLLIVLPYSLGLAVVGLLESMMT
ATIVDDLTDTSSDKNRECKGQGIANIFTGFLGGMAGCAMIGQSMINIKSGGRGRLSTLSA
GVFLLIMVVFLGPWLKQIPMAALVSVMIMVAIGTFSWRSITDLKKHPLSTNIVMLVTVII
VVMTHNLAIGVLVGVLLASLFFANKISRMMVIKNNSEETKSREYIVIGQVFFASSDKFIA
SFDFKEVIECVTIDLSAAHFWDITSASALDKVVVKFRREGTQVELIGMNQATKTIVDKFG
VHDKPEEVEKLLAGH
Download sequence
Identical sequences Q5DYM4
WP_011263860.1.76652 YP_207010.1.56684 gi|59714235|ref|YP_207010.1| APC64212 312309.VF_A1052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]