SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC64418 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC64418
Domain Number 1 Region: 393-484
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000108
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) APC64418
Sequence length 493
Comment $ MCSG $ SQ178553 $ PDBT90044 $
Sequence
MNRFQTYRREWFSNIRGDVLSGIVVALALIPEAIGFSVIAGVDPKVGLFASFAIACVSAF
TGGRPGMISAATAATAVLMVTLVKEHGLQYLFAATILMGVLQIAAGFAKLGRVMRFVSRS
VMTGFVNALAILIFMAQLPELIGVPVETYVMIAAGLAIIYLFPLVTKIIPSPLVAIVALT
CVAVFSGMDIRTVGDLGELPSTLPIFALPQVPLTFETLQIIFPYSIALAAVGLLESLLTA
QIVDDMTDTGSNKSQECIGQGTSNIASALIGGMGGCAMIGQSVINVRSGGRGRLSTFVAG
AFLLFLILVLDDLVRIIPMAALVAVMIMVSIGTFSWRSILDLTRNPPSSSIVMLVTVGTV
LATHDLAKGVLAGVLLSGVFFAGKVSKLFHVRPELSADGRERIYRVDGQIFFASTESFIA
AFDFAEEVEAVTIDVTQAHLWDISAVGALDKVVLKFRKTGKRVEVIGVNEASAHMIDRFA
LHDKPDAAAAPLH
Download sequence
Identical sequences Q7CZV0
APC64418 GO.8899 NP_354175.2.86381 WP_010971436.1.51814 WP_010971436.1.57042 gi|159184641|ref|NP_354175.2| 176299.Atu1156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]