SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC64590 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC64590
Domain Number 1 Region: 1-113
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.3e-21
Family Anti-sigma factor antagonist SpoIIaa 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC64590
Sequence length 118
Comment $ MCSG $ SQ178993 $ PDBT90529 $
Sequence
MRIPILKLKQYLLISIQVELDDQTALRFQEDLLTKIHQEGSEGVVIDLTSVETIDSFIAK
VLGDVVNMANLMGAKVVLTGIQPAVAITLIDMGIKLENVPTALDLDQGLEKLQQELEG
Download sequence
Identical sequences Q9KFF5
APC64590 272558.BH0524 WP_010896702.1.28103 gi|15613087|ref|NP_241390.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]