SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC64810 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC64810
Domain Number 1 Region: 154-248
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000412
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) APC64810
Sequence length 278
Comment $ MCSG $ SQ179513 $ PDBT91118 $
Sequence
MYKDFANFIRTNKADLLNNWMNEMEKQSDQLINDIAKEAMYEETSKEFVDLIVSNVTENG
SKFNEKLDDFAEKVVHLGWPIHFVTTGLRVFGLLVYTAMRDEDLFLKREEKPEDDAYYRF
ETWLSSMYNKVVTAYADTWEKTVSIQKSALQELSAPLLPIFEKISVMPLIGTIDTERAKL
IIENLLIGVVKNRSEVVLIDITGVPVVDTMVAHHIIQASEAVRLVGCQAMLVGIRPEIAQ
TIVNLGIELDQIITTNTMKKGMERALALTNREIVEKEG
Download sequence
Identical sequences A0A0E0UU04 A0A0E1R477 A0A0E1Y750 A0A241SMY2 Q8GD19
gi|226223508|ref|YP_002757615.1| gi|404286299|ref|YP_006692885.1| gi|386731644|ref|YP_006205140.1| APC64810 gi|424713768|ref|YP_007014483.1| gi|386026209|ref|YP_005946985.1| gi|46907121|ref|YP_013510.1| gi|405752108|ref|YP_006675573.1| gi|386007616|ref|YP_005925894.1| gi|404280440|ref|YP_006681338.1| gi|217965014|ref|YP_002350692.1| gi|406703664|ref|YP_006754018.1| WP_003724817.1.100060 WP_003724817.1.100142 WP_003724817.1.100147 WP_003724817.1.100160 WP_003724817.1.100221 WP_003724817.1.10039 WP_003724817.1.100458 WP_003724817.1.100522 WP_003724817.1.100651 WP_003724817.1.10073 WP_003724817.1.100835 WP_003724817.1.101318 WP_003724817.1.101527 WP_003724817.1.101529 WP_003724817.1.10176 WP_003724817.1.101811 WP_003724817.1.10182 WP_003724817.1.10210 WP_003724817.1.102145 WP_003724817.1.102150 WP_003724817.1.10460 WP_003724817.1.11086 WP_003724817.1.1160 WP_003724817.1.11633 WP_003724817.1.11689 WP_003724817.1.11907 WP_003724817.1.12020 WP_003724817.1.12028 WP_003724817.1.12142 WP_003724817.1.12148 WP_003724817.1.12278 WP_003724817.1.12287 WP_003724817.1.12417 WP_003724817.1.12544 WP_003724817.1.12993 WP_003724817.1.13004 WP_003724817.1.13180 WP_003724817.1.13329 WP_003724817.1.13360 WP_003724817.1.13684 WP_003724817.1.13779 WP_003724817.1.13847 WP_003724817.1.13855 WP_003724817.1.14029 WP_003724817.1.14636 WP_003724817.1.14641 WP_003724817.1.14832 WP_003724817.1.14875 WP_003724817.1.14895 WP_003724817.1.15085 WP_003724817.1.15122 WP_003724817.1.15340 WP_003724817.1.15342 WP_003724817.1.15495 WP_003724817.1.155 WP_003724817.1.15564 WP_003724817.1.15618 WP_003724817.1.15619 WP_003724817.1.15847 WP_003724817.1.16403 WP_003724817.1.16516 WP_003724817.1.16631 WP_003724817.1.1667 WP_003724817.1.16746 WP_003724817.1.1678 WP_003724817.1.1688 WP_003724817.1.17106 WP_003724817.1.17131 WP_003724817.1.17398 WP_003724817.1.17399 WP_003724817.1.18026 WP_003724817.1.18289 WP_003724817.1.18677 WP_003724817.1.18833 WP_003724817.1.19112 WP_003724817.1.19167 WP_003724817.1.19195 WP_003724817.1.19246 WP_003724817.1.1929 WP_003724817.1.19372 WP_003724817.1.19443 WP_003724817.1.19452 WP_003724817.1.19472 WP_003724817.1.19549 WP_003724817.1.19584 WP_003724817.1.19607 WP_003724817.1.19615 WP_003724817.1.19685 WP_003724817.1.197 WP_003724817.1.20263 WP_003724817.1.20378 WP_003724817.1.20548 WP_003724817.1.20672 WP_003724817.1.21371 WP_003724817.1.21428 WP_003724817.1.21429 WP_003724817.1.21527 WP_003724817.1.21567 WP_003724817.1.21597 WP_003724817.1.21706 WP_003724817.1.21711 WP_003724817.1.21874 WP_003724817.1.21889 WP_003724817.1.22188 WP_003724817.1.22194 WP_003724817.1.22221 WP_003724817.1.22383 WP_003724817.1.22468 WP_003724817.1.22597 WP_003724817.1.23060 WP_003724817.1.23139 WP_003724817.1.23255 WP_003724817.1.23291 WP_003724817.1.233 WP_003724817.1.23419 WP_003724817.1.23425 WP_003724817.1.23433 WP_003724817.1.23448 WP_003724817.1.23781 WP_003724817.1.23828 WP_003724817.1.23848 WP_003724817.1.24048 WP_003724817.1.24075 WP_003724817.1.24115 WP_003724817.1.24335 WP_003724817.1.24422 WP_003724817.1.24531 WP_003724817.1.24600 WP_003724817.1.24667 WP_003724817.1.24847 WP_003724817.1.24867 WP_003724817.1.24934 WP_003724817.1.24975 WP_003724817.1.25300 WP_003724817.1.2545 WP_003724817.1.25456 WP_003724817.1.25471 WP_003724817.1.25500 WP_003724817.1.25616 WP_003724817.1.25746 WP_003724817.1.25788 WP_003724817.1.25805 WP_003724817.1.25896 WP_003724817.1.26166 WP_003724817.1.26170 WP_003724817.1.26322 WP_003724817.1.2662 WP_003724817.1.26634 WP_003724817.1.2666 WP_003724817.1.26957 WP_003724817.1.27056 WP_003724817.1.27132 WP_003724817.1.27231 WP_003724817.1.27517 WP_003724817.1.27681 WP_003724817.1.27860 WP_003724817.1.27891 WP_003724817.1.27948 WP_003724817.1.28060 WP_003724817.1.28098 WP_003724817.1.2824 WP_003724817.1.28260 WP_003724817.1.2832 WP_003724817.1.28369 WP_003724817.1.2855 WP_003724817.1.28804 WP_003724817.1.28818 WP_003724817.1.29138 WP_003724817.1.29309 WP_003724817.1.29558 WP_003724817.1.29562 WP_003724817.1.29569 WP_003724817.1.29634 WP_003724817.1.29803 WP_003724817.1.29912 WP_003724817.1.30273 WP_003724817.1.30372 WP_003724817.1.30430 WP_003724817.1.30660 WP_003724817.1.30706 WP_003724817.1.30851 WP_003724817.1.3103 WP_003724817.1.31062 WP_003724817.1.31289 WP_003724817.1.31305 WP_003724817.1.31329 WP_003724817.1.31691 WP_003724817.1.31966 WP_003724817.1.32061 WP_003724817.1.32140 WP_003724817.1.32240 WP_003724817.1.32597 WP_003724817.1.32648 WP_003724817.1.32698 WP_003724817.1.32767 WP_003724817.1.33016 WP_003724817.1.33039 WP_003724817.1.3314 WP_003724817.1.33282 WP_003724817.1.33591 WP_003724817.1.3393 WP_003724817.1.34369 WP_003724817.1.34698 WP_003724817.1.34714 WP_003724817.1.34790 WP_003724817.1.34911 WP_003724817.1.3511 WP_003724817.1.35452 WP_003724817.1.35514 WP_003724817.1.35738 WP_003724817.1.36108 WP_003724817.1.36115 WP_003724817.1.3613 WP_003724817.1.36582 WP_003724817.1.36599 WP_003724817.1.36749 WP_003724817.1.37023 WP_003724817.1.37426 WP_003724817.1.37466 WP_003724817.1.37471 WP_003724817.1.37665 WP_003724817.1.37723 WP_003724817.1.37900 WP_003724817.1.37927 WP_003724817.1.37951 WP_003724817.1.38015 WP_003724817.1.38302 WP_003724817.1.38396 WP_003724817.1.38424 WP_003724817.1.38575 WP_003724817.1.38741 WP_003724817.1.38819 WP_003724817.1.3892 WP_003724817.1.39000 WP_003724817.1.39220 WP_003724817.1.39307 WP_003724817.1.39316 WP_003724817.1.39348 WP_003724817.1.39427 WP_003724817.1.39496 WP_003724817.1.39552 WP_003724817.1.39554 WP_003724817.1.39794 WP_003724817.1.39895 WP_003724817.1.40420 WP_003724817.1.40556 WP_003724817.1.40580 WP_003724817.1.40978 WP_003724817.1.41222 WP_003724817.1.41337 WP_003724817.1.41603 WP_003724817.1.4166 WP_003724817.1.41876 WP_003724817.1.42040 WP_003724817.1.42089 WP_003724817.1.42310 WP_003724817.1.42317 WP_003724817.1.42525 WP_003724817.1.42550 WP_003724817.1.42616 WP_003724817.1.42994 WP_003724817.1.43135 WP_003724817.1.43280 WP_003724817.1.43304 WP_003724817.1.43336 WP_003724817.1.43350 WP_003724817.1.43458 WP_003724817.1.43480 WP_003724817.1.43768 WP_003724817.1.43807 WP_003724817.1.43916 WP_003724817.1.44092 WP_003724817.1.44161 WP_003724817.1.44230 WP_003724817.1.44427 WP_003724817.1.44663 WP_003724817.1.4472 WP_003724817.1.44749 WP_003724817.1.44806 WP_003724817.1.4510 WP_003724817.1.45355 WP_003724817.1.45512 WP_003724817.1.45541 WP_003724817.1.45719 WP_003724817.1.45778 WP_003724817.1.45803 WP_003724817.1.4587 WP_003724817.1.45883 WP_003724817.1.45893 WP_003724817.1.46180 WP_003724817.1.46277 WP_003724817.1.4642 WP_003724817.1.46456 WP_003724817.1.46566 WP_003724817.1.46725 WP_003724817.1.46834 WP_003724817.1.46981 WP_003724817.1.47001 WP_003724817.1.47075 WP_003724817.1.47203 WP_003724817.1.47384 WP_003724817.1.47431 WP_003724817.1.47518 WP_003724817.1.47520 WP_003724817.1.4753 WP_003724817.1.47650 WP_003724817.1.47979 WP_003724817.1.48007 WP_003724817.1.48161 WP_003724817.1.48163 WP_003724817.1.48175 WP_003724817.1.48235 WP_003724817.1.48410 WP_003724817.1.48440 WP_003724817.1.48565 WP_003724817.1.48854 WP_003724817.1.49 WP_003724817.1.49390 WP_003724817.1.49391 WP_003724817.1.49458 WP_003724817.1.49507 WP_003724817.1.49708 WP_003724817.1.49754 WP_003724817.1.50044 WP_003724817.1.50063 WP_003724817.1.50288 WP_003724817.1.50293 WP_003724817.1.50662 WP_003724817.1.50765 WP_003724817.1.50775 WP_003724817.1.51086 WP_003724817.1.51262 WP_003724817.1.51384 WP_003724817.1.51493 WP_003724817.1.5170 WP_003724817.1.51768 WP_003724817.1.51980 WP_003724817.1.52142 WP_003724817.1.52290 WP_003724817.1.52420 WP_003724817.1.52507 WP_003724817.1.52782 WP_003724817.1.52829 WP_003724817.1.53051 WP_003724817.1.53426 WP_003724817.1.53566 WP_003724817.1.53603 WP_003724817.1.53870 WP_003724817.1.54281 WP_003724817.1.54434 WP_003724817.1.54506 WP_003724817.1.54508 WP_003724817.1.5472 WP_003724817.1.54740 WP_003724817.1.54750 WP_003724817.1.54884 WP_003724817.1.55068 WP_003724817.1.5514 WP_003724817.1.5538 WP_003724817.1.55386 WP_003724817.1.55423 WP_003724817.1.55494 WP_003724817.1.55609 WP_003724817.1.56322 WP_003724817.1.56344 WP_003724817.1.56415 WP_003724817.1.56557 WP_003724817.1.5671 WP_003724817.1.56748 WP_003724817.1.5687 WP_003724817.1.57106 WP_003724817.1.57228 WP_003724817.1.57536 WP_003724817.1.57913 WP_003724817.1.57932 WP_003724817.1.58 WP_003724817.1.58083 WP_003724817.1.58491 WP_003724817.1.58516 WP_003724817.1.58966 WP_003724817.1.59113 WP_003724817.1.59542 WP_003724817.1.59652 WP_003724817.1.59695 WP_003724817.1.59744 WP_003724817.1.59975 WP_003724817.1.60132 WP_003724817.1.60162 WP_003724817.1.60295 WP_003724817.1.60543 WP_003724817.1.60674 WP_003724817.1.60762 WP_003724817.1.60766 WP_003724817.1.61274 WP_003724817.1.61358 WP_003724817.1.61384 WP_003724817.1.61824 WP_003724817.1.61915 WP_003724817.1.6236 WP_003724817.1.62375 WP_003724817.1.62494 WP_003724817.1.62573 WP_003724817.1.6281 WP_003724817.1.62874 WP_003724817.1.63209 WP_003724817.1.63269 WP_003724817.1.63283 WP_003724817.1.63315 WP_003724817.1.63883 WP_003724817.1.64147 WP_003724817.1.64289 WP_003724817.1.64531 WP_003724817.1.64587 WP_003724817.1.64796 WP_003724817.1.64929 WP_003724817.1.65094 WP_003724817.1.65392 WP_003724817.1.65561 WP_003724817.1.65780 WP_003724817.1.65840 WP_003724817.1.66057 WP_003724817.1.66134 WP_003724817.1.66138 WP_003724817.1.66285 WP_003724817.1.66545 WP_003724817.1.66596 WP_003724817.1.66743 WP_003724817.1.66993 WP_003724817.1.6745 WP_003724817.1.67551 WP_003724817.1.67573 WP_003724817.1.67654 WP_003724817.1.67813 WP_003724817.1.67926 WP_003724817.1.68128 WP_003724817.1.68236 WP_003724817.1.68282 WP_003724817.1.68497 WP_003724817.1.68517 WP_003724817.1.68740 WP_003724817.1.69587 WP_003724817.1.69603 WP_003724817.1.69864 WP_003724817.1.6991 WP_003724817.1.70100 WP_003724817.1.70122 WP_003724817.1.7026 WP_003724817.1.7031 WP_003724817.1.70373 WP_003724817.1.70590 WP_003724817.1.70633 WP_003724817.1.70736 WP_003724817.1.71381 WP_003724817.1.71437 WP_003724817.1.71474 WP_003724817.1.7175 WP_003724817.1.71763 WP_003724817.1.71858 WP_003724817.1.71904 WP_003724817.1.72264 WP_003724817.1.72370 WP_003724817.1.72385 WP_003724817.1.72546 WP_003724817.1.72623 WP_003724817.1.72813 WP_003724817.1.72886 WP_003724817.1.73152 WP_003724817.1.73222 WP_003724817.1.73263 WP_003724817.1.734 WP_003724817.1.73448 WP_003724817.1.73458 WP_003724817.1.73508 WP_003724817.1.73545 WP_003724817.1.73613 WP_003724817.1.74095 WP_003724817.1.74148 WP_003724817.1.7421 WP_003724817.1.74436 WP_003724817.1.74617 WP_003724817.1.74728 WP_003724817.1.74823 WP_003724817.1.7504 WP_003724817.1.75072 WP_003724817.1.75196 WP_003724817.1.75216 WP_003724817.1.7553 WP_003724817.1.75548 WP_003724817.1.7565 WP_003724817.1.75838 WP_003724817.1.75869 WP_003724817.1.75923 WP_003724817.1.76094 WP_003724817.1.76120 WP_003724817.1.76168 WP_003724817.1.76254 WP_003724817.1.76608 WP_003724817.1.76982 WP_003724817.1.77191 WP_003724817.1.77261 WP_003724817.1.7738 WP_003724817.1.77389 WP_003724817.1.77594 WP_003724817.1.77675 WP_003724817.1.77849 WP_003724817.1.77943 WP_003724817.1.78088 WP_003724817.1.78130 WP_003724817.1.78328 WP_003724817.1.78717 WP_003724817.1.79149 WP_003724817.1.79259 WP_003724817.1.79602 WP_003724817.1.79821 WP_003724817.1.79962 WP_003724817.1.80088 WP_003724817.1.80514 WP_003724817.1.80693 WP_003724817.1.80896 WP_003724817.1.80968 WP_003724817.1.81140 WP_003724817.1.81270 WP_003724817.1.81315 WP_003724817.1.8151 WP_003724817.1.81647 WP_003724817.1.81693 WP_003724817.1.81725 WP_003724817.1.81863 WP_003724817.1.82294 WP_003724817.1.82372 WP_003724817.1.82480 WP_003724817.1.82605 WP_003724817.1.82616 WP_003724817.1.82662 WP_003724817.1.82974 WP_003724817.1.83015 WP_003724817.1.83130 WP_003724817.1.83217 WP_003724817.1.83236 WP_003724817.1.83755 WP_003724817.1.83877 WP_003724817.1.8391 WP_003724817.1.8465 WP_003724817.1.8473 WP_003724817.1.84895 WP_003724817.1.84974 WP_003724817.1.85172 WP_003724817.1.85194 WP_003724817.1.85317 WP_003724817.1.85321 WP_003724817.1.8539 WP_003724817.1.85887 WP_003724817.1.85890 WP_003724817.1.86056 WP_003724817.1.86571 WP_003724817.1.86752 WP_003724817.1.87101 WP_003724817.1.8715 WP_003724817.1.87179 WP_003724817.1.87294 WP_003724817.1.87328 WP_003724817.1.87329 WP_003724817.1.87436 WP_003724817.1.87537 WP_003724817.1.87890 WP_003724817.1.87903 WP_003724817.1.88055 WP_003724817.1.88211 WP_003724817.1.88422 WP_003724817.1.88463 WP_003724817.1.88639 WP_003724817.1.88768 WP_003724817.1.88783 WP_003724817.1.88800 WP_003724817.1.88806 WP_003724817.1.88895 WP_003724817.1.89014 WP_003724817.1.89127 WP_003724817.1.89267 WP_003724817.1.89302 WP_003724817.1.89387 WP_003724817.1.89812 WP_003724817.1.89897 WP_003724817.1.89969 WP_003724817.1.90135 WP_003724817.1.90212 WP_003724817.1.90326 WP_003724817.1.90459 WP_003724817.1.90524 WP_003724817.1.90645 WP_003724817.1.90646 WP_003724817.1.90741 WP_003724817.1.90857 WP_003724817.1.90963 WP_003724817.1.91084 WP_003724817.1.91140 WP_003724817.1.91195 WP_003724817.1.91212 WP_003724817.1.91920 WP_003724817.1.92288 WP_003724817.1.9243 WP_003724817.1.9282 WP_003724817.1.92928 WP_003724817.1.92963 WP_003724817.1.93014 WP_003724817.1.93049 WP_003724817.1.93325 WP_003724817.1.93421 WP_003724817.1.93490 WP_003724817.1.93534 WP_003724817.1.93558 WP_003724817.1.93611 WP_003724817.1.93712 WP_003724817.1.93867 WP_003724817.1.94026 WP_003724817.1.94081 WP_003724817.1.94206 WP_003724817.1.94225 WP_003724817.1.94233 WP_003724817.1.94401 WP_003724817.1.94431 WP_003724817.1.94447 WP_003724817.1.94464 WP_003724817.1.94537 WP_003724817.1.94554 WP_003724817.1.94613 WP_003724817.1.9470 WP_003724817.1.94759 WP_003724817.1.94795 WP_003724817.1.94906 WP_003724817.1.9502 WP_003724817.1.9505 WP_003724817.1.95100 WP_003724817.1.95146 WP_003724817.1.9517 WP_003724817.1.95197 WP_003724817.1.95256 WP_003724817.1.95696 WP_003724817.1.96084 WP_003724817.1.96156 WP_003724817.1.96422 WP_003724817.1.96438 WP_003724817.1.96449 WP_003724817.1.96542 WP_003724817.1.96544 WP_003724817.1.96596 WP_003724817.1.96605 WP_003724817.1.96708 WP_003724817.1.96751 WP_003724817.1.96835 WP_003724817.1.96867 WP_003724817.1.97140 WP_003724817.1.97257 WP_003724817.1.97469 WP_003724817.1.97569 WP_003724817.1.97587 WP_003724817.1.97589 WP_003724817.1.9768 WP_003724817.1.9769 WP_003724817.1.97803 WP_003724817.1.97900 WP_003724817.1.97970 WP_003724817.1.9802 WP_003724817.1.98060 WP_003724817.1.98375 WP_003724817.1.9840 WP_003724817.1.98689 WP_003724817.1.98826 WP_003724817.1.98829 WP_003724817.1.99125 WP_003724817.1.99199 WP_003724817.1.99553 WP_003724817.1.99568 WP_003724817.1.99702 WP_003724817.1.99737 WP_003724817.1.99818 WP_003724817.1.99836 265669.LMOf2365_0908 552536.LMHCC_1737 634178.Lm4b_00907 gi|525721444|ref|YP_008285839.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]