SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC65383 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC65383
Domain Number 1 Region: 396-484
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000275
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC65383
Sequence length 495
Comment $ MCSG $ SQ180933 $ PDBT92720 $
Sequence
MKTTITSYKREWFSNIRGDVLSGIVVALALIPEAIGFSVIAGVDPKVGLFASFAIACVSA
FAGGRPGMISAATAATAVLMVTLVKEHGLEYLFAATLLMGLFQIAAGFLKLGRVMRFVSR
SVITGFVNALAILIFMAQLPELIGVPHLTYAMIAAGLGIIYLFPYVTKAVPSPLVAIAVL
TAVDFWTGMDVRTVGDLGALPSSLPIFALPQVPLTFETLQIIFPYSVALAAVGLLESLLT
AQIVDDMTDTTSSKSQECIGQGASNIASGLIGGMGGCAMIGQSVINVTSGGRGRLSTFVA
GAFLLFLILVLDDLVRIIPMAALVAVMIMVSVGTFSWRSILDLRRNPLPSSVVMLATVVT
TVGTHDLAKGVLVGVLLSGVFFAGKVARLFHVRSMLEESGKVRTYHVDGQIFFASTEGFI
GAFDFAEPLEKVVIDVGEAHLWDITAVGALDKVVLKYRRHGVTVEVIGLNAASAHMLDRF
AVHDKSEGASLTVTH
Download sequence
Identical sequences Q92X92
NP_436610.1.96377 WP_010974992.1.4234 WP_010974992.1.787 266834.SM_b20070 gi|16263818|ref|NP_436610.1|NC_003078 gi|470185441|ref|YP_007612813.1|NC_020560 APC65383 gi|470185441|ref|YP_007612813.1| gi|16263818|ref|NP_436610.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]