SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC65479 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC65479
Domain Number 1 Region: 170-280
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.06e-17
Family Anti-sigma factor antagonist SpoIIaa 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) APC65479
Sequence length 299
Comment $ MCSG $ SQ181179 $ PDBT92977 $
Sequence
MTDQEPVAHHEAPTQALGDFLRRRREQIAQRWADEALFRTVFTVSRDEAVEAAGAVVEAL
AAVAFSERIENLGATGFAAVREQLGRMAAARSRAGASADQIADDVSALRPSITELLNADL
SEAPDEDARELLITLTVLLGTLRLVVLETVLTAGEELIERQRLQLLEVATPVIKLWTGIV
AVPLIGTLDSARSQVVMESLLDAVVAQQARFAILDITGVPTVDSLVAQHLMKTVAAARLM
GAECIVSGIRPAIAQTIVHLGIDLGTVVTRASLADALGYALHRQGAVIVDQASAGGIQQ
Download sequence
Identical sequences Q82P39
227882.SAV_1094 gi|29827635|ref|NP_822269.1| APC65479

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]