SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC65480 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC65480
Domain Number 1 Region: 13-122
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.2e-18
Family Anti-sigma factor antagonist SpoIIaa 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC65480
Sequence length 139
Comment $ MCSG $ SQ181183 $ PDBT92981 $
Sequence
MIGDPLGRPGIHVPVLKLGNVLLVTLQGDLHDHAAEQLQQDIGEAVASSAVTGVVIDVSG
VEIVDSFLGRVFAEIAATARLLAAQTIVAGMRPAVAITLVELGLTLPGLRTALDAEQAMR
LLTGTPPHLPHVPGRRESA
Download sequence
Identical sequences Q82P38
WP_010982533.1.19017 WP_010982533.1.30226 WP_010982533.1.49792 WP_010982533.1.60620 WP_010982533.1.68722 APC65480 227882.SAV_1095 gi|29827636|ref|NP_822270.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]