SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC65547 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC65547
Domain Number 1 Region: 407-486
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000863
Family Anti-sigma factor antagonist SpoIIaa 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) APC65547
Sequence length 499
Comment $ MCSG $ SQ181347 $ PDBT93159 $
Sequence
MTPTTPAARLRALKPDWLNDPKVWRTEILAGLVVALALIPEAISFSIIAGVDPAIGLFAS
FTMAVTISIVGGRRAMISAATGAVALVIAPMNREHGLGYLIATVILAGVFQIVLGAVGVA
KLMRFVPRSVMTGFVNALAVMIFMAQVPEMHDVPWPVYPLIVGGLALMVFFPKVTRVVPA
PLVSIVILTVITVAAGIAVPTVGDKGELPSSLPVPGLPDVPFTLDTLTTVAPYALAMALV
GLMESLMTARLVDDITDTHSSKTRESIGQGVANIVTGFFGGMGGCAMIGQTMINVKVSGA
RTRVSTFLAGSFLMVLCIVFGPVVSDIPMAALVAVMVMVAFGTFDWHSVAPKTLKRMPAG
EIAVMIITVIVVVATDNLAIGVVVGTVTAMVVFARRVAHLAQVTAVTDPDGTTVVYRVTG
ELFFASSNDLVGQFDYAGDPDRVVIDLSAAHIWDASSVAALDAIETKYGQRGKSVEITGL
NTPSADLHGRLTGELTGSH
Download sequence
Identical sequences Q9X8E9
100226.SCO3276 APC65547 NP_627488.1.49638 gi|21221709|ref|NP_627488.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]