SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC65548 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC65548
Domain Number 1 Region: 170-280
Classification Level Classification E-value
Superfamily SpoIIaa-like 3.14e-19
Family Anti-sigma factor antagonist SpoIIaa 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) APC65548
Sequence length 299
Comment $ MCSG $ SQ181348 $ PDBT93160 $
Sequence
MPEQAEGTAGAPTREVRDFLRRHREQIAQRWADEPLFRAVFTVSRDEAVEAAKAVVDALD
QVADAARVEDPDAAGFTAVREQLARMGAARSRAGLSTAQVSSELAALRPPVENLLVAALP
DQAPAEHVRDCVTALNVLMGTLRVVVMQTALSEGQALIDRQRLQLLEVATPVIKLWDGIV
AVPLIGTLDSARSQVVMETLLESIVEQQARYAILDITGVPTVDSLVAQHLMKTVAAARLM
GAECIVSGIRPAIAQTMVHLGLDLGTVVTRASLADALGYVLHQLGVGIVTPHANGAVAR
Download sequence
Identical sequences A0A1H2DG05 D6EX60 Q9KY14
APC65548 NP_631378.1.49638 WP_003971817.1.26049 WP_003971817.1.30910 WP_003971817.1.43399 WP_003971817.1.55229 WP_003971817.1.58943 WP_003971817.1.86682 100226.SCO7324 gi|21225599|ref|NP_631378.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]