SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC65641 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC65641
Domain Number 1 Region: 406-486
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000104
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) APC65641
Sequence length 498
Comment $ MCSG $ SQ181590 $ PDBT93431 $
Sequence
MSPMSFLRTELAQWRASPARELMAGAVATFALIPEVIAFAFVAGVDPQVGLFASFVIGIV
IAFCGGRPAMISAAAGSVALVAAPLVATHGLPYLLAAGLLAGLVQIVFGLLRLGVLMRFV
SSSVRTGFVNALAVLIFAAQLPHLLGANPTTWVTLGVGLAIIYGLPRLRLPGVSAIPSPL
LCILLLTVASSALHLPLKTVADLGKLPTALPFLQWPGVPLTLETLRIIALPALAIAMVGL
LESMMTARVVDELTDTPSNKNRECTGLGLANAAASLFGGIAGCGMIGQTVGNVKYGGRGR
LSTLFAGVFLLILMVLLKPWVSQVPVVALVAIMVMVSAETFDWRSLRTVITHPRTSSVVM
LATVAVTLATHNLAAGVAVGVLLSGVFFTFKVSGLLQIVPSDAANPLRTYSVRGQVFFAS
ADVFIDAFDARDVPGQQVIIDVSRAHFWDITAVAALDKVVQRLRHHGLQVQVQGLNAASR
RLMQAHALGEDALESALP
Download sequence
Identical sequences A0A0H2X585 Q8P527
NP_638866.1.47755 WP_011038612.1.10627 WP_011038612.1.12496 WP_011038612.1.1732 WP_011038612.1.18295 WP_011038612.1.22538 WP_011038612.1.27778 WP_011038612.1.31612 WP_011038612.1.36111 WP_011038612.1.40219 WP_011038612.1.43481 WP_011038612.1.4502 WP_011038612.1.475 WP_011038612.1.56666 WP_011038612.1.82601 WP_011038612.1.88278 gi|21232949|ref|NP_638866.1| gi|66766978|ref|YP_241740.1| 190485.XCC3520 314565.XC_0640 APC65641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]