SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC65643 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC65643
Domain Number 1 Region: 158-268
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.47e-17
Family Anti-sigma factor antagonist SpoIIaa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) APC65643
Sequence length 280
Comment $ MCSG $ SQ116875 $ PDBT93435 $
Sequence
MVALQQRTIDAIRGQEGGLLSAWLGSSLTADARISHKDAQAQGADFLRLLAASLKDGGSS
LDSAEWSEVRRFLENLSRDRATRGFDSQETANFLFSLKRALFELVQREYADTPEELGHQL
WALSELMDALGLHTIKAFQKTREDIIARQQEEMLELSTPVVKLWEGVLALPMIGTLDSQR
TQVVMESLLQRIVDTGSEIAIIDITGVPTVDTLVAQHLLKTVTAIRLMGADAIISGVRPQ
IAQTIVHLGLDLQGIVTKANLADALALALKRTGVTVSKAG
Download sequence
Identical sequences A0A0H2X9Z3 B0RY12 Q8PBF1
NP_636545.1.47755 WP_011036368.1.10627 WP_011036368.1.12135 WP_011036368.1.15229 WP_011036368.1.1732 WP_011036368.1.18295 WP_011036368.1.18975 WP_011036368.1.22538 WP_011036368.1.27778 WP_011036368.1.36111 WP_011036368.1.36449 WP_011036368.1.4502 WP_011036368.1.475 WP_011036368.1.80866 WP_011036368.1.82601 WP_011036368.1.89271 gi|21230628|ref|NP_636545.1| 368907 APC65643 gi|188992562|ref|YP_001904572.1| gi|66769376|ref|YP_244138.1| 190485.XCC1171 314565.XC_3072 509169.xccb100_3167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]