SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC7056 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC7056
Domain Number 1 Region: 23-106
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000126
Family Anti-sigma factor antagonist SpoIIaa 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC7056
Sequence length 113
Comment $ MCSG $ SQ101593 $ PDBT58632 $
Sequence
MHRCGESSVAGTDARIRLEGNRLFVGGPVTYDNVVEVIRTGDAAIKADDMLIDLAGVTWV
DSSAVSMLLEWMRTAQTYDRRIEFINLPSNLADLIELYDVGSLIPTDKPAESV
Download sequence
Identical sequences Q82SF9
APC7056 WP_011112853.1.11244 WP_011112853.1.14462 WP_011112853.1.55826 WP_011112853.1.61914 gi|30250305|ref|NP_842375.1| 228410.NE2380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]