SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC7079 from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  APC7079
Domain Number - Region: 126-172
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00883
Family Anti-sigma factor antagonist SpoIIaa 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) APC7079
Sequence length 227
Comment $ MCSG $ SQ101614 $ PDBT58657 $
Sequence
MSADNLLLDFTSPGAIPPDPAEVVRRVVDETQTTMRALESLLENERIEDMTGWRLLAMFY
LATDRLNDLAKIEKQYKSITGVSLSADLKQKYPQWFNGEAVSHPVVFEIPKKITAAALPD
SIIIQRGQCSPGGILLDFSQVQEIDNDGLKKLAQLFSSLAQENTRPKLRQADRFITCLQN
KAETGTGTRAIWDVLFAYERFRDDREAFEEKAIKFAVLYGISPPSWE
Download sequence
Identical sequences A0A1I0AHD9 Q82XB8
APC7079 228410.NE0367 WP_011111002.1.11244 WP_011111002.1.14462 WP_011111002.1.55826 WP_011111002.1.61914 gi|30248384|ref|NP_840454.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]