SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC798 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC798
Domain Number 1 Region: 444-546
Classification Level Classification E-value
Superfamily SpoIIaa-like 2.94e-16
Family Anti-sigma factor antagonist SpoIIaa 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) APC798
Sequence length 549
Comment $ MCSG $ SQ14602 $ PDBT54723 $
Sequence
MRNESLPARVGAEPLLPMSVTAFAEGYDLARLRADLLAGLTVAIVALPLSMAIAIASGVG
PERGLFTAIIGGFLISALGGSRYQIGGPAGAFIVLVLACVTATGVSGLVLATFLSGGMLA
VLGLLRLGSTIRYMPYPVTVGFTSGIGVIIFASQIKDMAGLTLAGGEPGPILEKLSALWA
ARDTVSPTAVGVALATVALIEALKRFAPRLPSLLLGIATITLAATLLNLPVETIQSRFGG
LPRLLPAPALPEISLETVRAALPWAFSFTLLGAIESLLSAMVADGMSGTQHRSNIELVAQ
GVANMGAALFGGFCVTGTIARTATNVRAGASGPAAGMFHALFILGFMIVAAPLAGYIPLA
ALAGLLGIVAWNMIERHEMAALIRSSKGDALVLIVTFVVVVFRDLAEGIVLGFALGGLVF
IRHMSEMTALDEGVTHARSTGPARRDVVTYHLRGAVFFGSVARLGSVLDRIASHPRAVLL
DVSGVGFVDSTGARMIGQMAQKLGRRGERLMVLGATPAIEAAMRAQGLTEPLLCYCPDTE
AALARLDAA
Download sequence
Identical sequences A0A0E2PRS6 D5AN61
APC798 WP_013068330.1.101009 WP_013068330.1.44490 WP_013068330.1.45363 WP_013068330.1.65902 WP_013068330.1.82813 gi|294678143|ref|YP_003578758.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]