SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for APC82809.2 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC82809.2
Domain Number 1 Region: 7-170
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.48e-32
Family Cystathionine synthase-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) APC82809.2
Sequence length 173
Comment $ MCSG $ SQ95842 $ PDBT101075 $
Sequence
AGVSDTAASVCITITAPSKAWNIAGLKCAQIIFSNPSDAEHWQQLSPVIKDGASTLGLIA
AEAAYRYGTDFLNQEVAYLKNNHDFLLHEIPKRIPGAKITPMQATYLMWIDFRDTTIEGS
PSEFFIEKAKVAMNDGAWFGEDGTGFCRLNFATSREVLEEAIDRMAKAVSHHT
Download sequence
Identical sequences APC82809.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]