SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC83629 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC83629
Domain Number 1 Region: 1-125
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.22e-34
Family Sfri0576-like 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) APC83629
Sequence length 132
Comment $ MCSG $ SQ27470 $ PDBT101268 $
Sequence
MTLLKHGISVGIERYGDDDFFVAFKAIGTLTHQDYEVMVPVLEAALAGVKDPDIYALVDV
TELDGWELQAAWDDLKLGVKHIRHFERIAVVGKTTFQEVMAKLANGLTPAKVKFFVDKLD
AITWLKEELHDD
Download sequence
Identical sequences Q8EB52
NP_719223.1.27637 gi|24375180|ref|NP_719223.1| 211586.SO_3682 APC83629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]