SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for APC91102.1 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC91102.1
Domain Number 1 Region: 36-126
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000216
Family Anti-sigma factor antagonist SpoIIaa 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) APC91102.1
Sequence length 177
Comment $ MCSG $ SQ97654 $ PDBT114554 $
Sequence
GLFQFLRIVMRPSDQLLGLDEKGTIRTIDETGKASPIPGMVIYRFNSPLTYFNAPYFKRR
LLEHAEQNKDVSCVVVDAVSSFTHLDLSVMATLADIHEVLKKRGIRLVLAGRKRRLRQWC
ELTGISTSEGGILLRADMYLAIKLSGSYLSAVGEGIVPTVQKEPDLEQPPKPIPEVA
Download sequence
Identical sequences APC91102.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]