SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for APC92072.3 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  APC92072.3
Domain Number 1 Region: 66-151
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000286
Family V set domains (antibody variable domain-like) 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) APC92072.3
Sequence length 161
Comment $ MCSG $ SQ155940 $ PDBT115380 $
Sequence
GELFIKELLWMLRHQKDIFNNLARQFQKEVLCPNKCGVMSQTLIWCLKCEKQLHICRKSL
DCGERHIEVHRSEDLVLDCLLSWHRASKGLTDYSFYRVWENSSETLIAKGKEPYLTKSMV
GPEDAGNYRCVLDTINQGHATVIRYDVTVLPPKHSEENQPP
Download sequence
Identical sequences APC92072.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]