SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ATCG3D_16 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ATCG3D_16
Domain Number 1 Region: 4-205
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.15e-52
Family DBL homology domain (DH-domain) 0.0000000158
Further Details:      
 
Domain Number 2 Region: 192-354
Classification Level Classification E-value
Superfamily PH domain-like 7.17e-35
Family Pleckstrin-homology domain (PH domain) 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) ATCG3D_16
Sequence length 377
Comment $ ATCG3D $ SQ182704 $ PDBT348203 $
Sequence
MTEYDKRCCCLREIQQTEEKYTDTLGSIQQHFLKPLQRFLKPQDIEIIFINIEDLLRVHT
HFLKEMKEALGTPGAANLYQVFIKYKERFLVYGRYCSQVESASKHLDRVAAAREDVQMKL
EECSQRANNGRFTLRDLLMVPMQRVLKYHLLLQELVKHTQEAMEKENLRLALDAMRDLAQ
CVNEVKRDNETLRQITNFQLSIENLDQSLAHYGRPKIDGELKITSVERRSKMDRYAFLLD
KALLICKRRGDSYDLKDFVNLHSFQVRDDSSGDRDNKKWSHMFLLIEDQGAQGYELFFKT
RELKKKWMEQFEMAISNIYPENATANGHDFQMFSFEETTSCKACQMLLRGTFYQGYRCHR
CRASAHKECLGRVPPCG
Download sequence
Identical sequences ATCG3D_16

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]