SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C09D1.1 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C09D1.1
Domain Number 1 Region: 340-454
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-25
Family Pleckstrin-homology domain (PH domain) 0.000000502
Further Details:      
 
Domain Number 2 Region: 3920-4013
Classification Level Classification E-value
Superfamily Immunoglobulin 1.72e-24
Family I set domains 0.0096
Further Details:      
 
Domain Number 3 Region: 5383-5477
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-23
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 5594-5683
Classification Level Classification E-value
Superfamily Immunoglobulin 3.48e-23
Family I set domains 0.009
Further Details:      
 
Domain Number 5 Region: 646-741
Classification Level Classification E-value
Superfamily Immunoglobulin 4.1e-23
Family I set domains 0.0017
Further Details:      
 
Domain Number 6 Region: 5487-5578
Classification Level Classification E-value
Superfamily Immunoglobulin 8.2e-23
Family I set domains 0.0084
Further Details:      
 
Domain Number 7 Region: 3480-3575
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-22
Family I set domains 0.0026
Further Details:      
 
Domain Number 8 Region: 145-329
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-22
Family DBL homology domain (DH-domain) 0.00025
Further Details:      
 
Domain Number 9 Region: 5815-5909
Classification Level Classification E-value
Superfamily Immunoglobulin 2.87e-22
Family I set domains 0.011
Further Details:      
 
Domain Number 10 Region: 5073-5164
Classification Level Classification E-value
Superfamily Immunoglobulin 3.99e-22
Family I set domains 0.043
Further Details:      
 
Domain Number 11 Region: 3817-3908
Classification Level Classification E-value
Superfamily Immunoglobulin 4.21e-22
Family I set domains 0.022
Further Details:      
 
Domain Number 12 Region: 3580-3671
Classification Level Classification E-value
Superfamily Immunoglobulin 6.62e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 13 Region: 3286-3378
Classification Level Classification E-value
Superfamily Immunoglobulin 8.97e-22
Family I set domains 0.0064
Further Details:      
 
Domain Number 14 Region: 6148-6241
Classification Level Classification E-value
Superfamily Immunoglobulin 1.07e-21
Family I set domains 0.0091
Further Details:      
 
Domain Number 15 Region: 4018-4109
Classification Level Classification E-value
Superfamily Immunoglobulin 3.71e-21
Family I set domains 0.0081
Further Details:      
 
Domain Number 16 Region: 5701-5795
Classification Level Classification E-value
Superfamily Immunoglobulin 6.55e-21
Family I set domains 0.027
Further Details:      
 
Domain Number 17 Region: 2887-2983
Classification Level Classification E-value
Superfamily Immunoglobulin 1.95e-20
Family I set domains 0.012
Further Details:      
 
Domain Number 18 Region: 3686-3777
Classification Level Classification E-value
Superfamily Immunoglobulin 2.35e-20
Family I set domains 0.0025
Further Details:      
 
Domain Number 19 Region: 3381-3473
Classification Level Classification E-value
Superfamily Immunoglobulin 2.8e-20
Family I set domains 0.0039
Further Details:      
 
Domain Number 20 Region: 1044-1140
Classification Level Classification E-value
Superfamily Immunoglobulin 3.19e-20
Family I set domains 0.0059
Further Details:      
 
Domain Number 21 Region: 748-844
Classification Level Classification E-value
Superfamily Immunoglobulin 5.1e-20
Family I set domains 0.0035
Further Details:      
 
Domain Number 22 Region: 6507-6599
Classification Level Classification E-value
Superfamily Immunoglobulin 8.15e-20
Family I set domains 0.0048
Further Details:      
 
Domain Number 23 Region: 4684-4774
Classification Level Classification E-value
Superfamily Immunoglobulin 1.71e-19
Family I set domains 0.007
Further Details:      
 
Domain Number 24 Region: 560-640
Classification Level Classification E-value
Superfamily Immunoglobulin 1.19e-18
Family I set domains 0.0063
Further Details:      
 
Domain Number 25 Region: 2660-2754
Classification Level Classification E-value
Superfamily Immunoglobulin 1.35e-18
Family I set domains 0.0055
Further Details:      
 
Domain Number 26 Region: 2367-2458
Classification Level Classification E-value
Superfamily Immunoglobulin 1.45e-18
Family I set domains 0.014
Further Details:      
 
Domain Number 27 Region: 5924-6016
Classification Level Classification E-value
Superfamily Immunoglobulin 1.52e-18
Family I set domains 0.0042
Further Details:      
 
Domain Number 28 Region: 6038-6134
Classification Level Classification E-value
Superfamily Immunoglobulin 1.66e-18
Family I set domains 0.0077
Further Details:      
 
Domain Number 29 Region: 2994-3084
Classification Level Classification E-value
Superfamily Immunoglobulin 1.66e-18
Family I set domains 0.014
Further Details:      
 
Domain Number 30 Region: 5274-5367
Classification Level Classification E-value
Superfamily Immunoglobulin 2.82e-18
Family I set domains 0.0067
Further Details:      
 
Domain Number 31 Region: 2075-2165
Classification Level Classification E-value
Superfamily Immunoglobulin 1.95e-17
Family I set domains 0.0085
Further Details:      
 
Domain Number 32 Region: 4212-4306
Classification Level Classification E-value
Superfamily Immunoglobulin 5.43e-17
Family I set domains 0.012
Further Details:      
 
Domain Number 33 Region: 6272-6379
Classification Level Classification E-value
Superfamily Fibronectin type III 5.65e-17
Family Fibronectin type III 0.0007
Further Details:      
 
Domain Number 34 Region: 5168-5257
Classification Level Classification E-value
Superfamily Immunoglobulin 7.08e-17
Family I set domains 0.016
Further Details:      
 
Domain Number 35 Region: 3189-3279
Classification Level Classification E-value
Superfamily Immunoglobulin 2e-16
Family I set domains 0.007
Further Details:      
 
Domain Number 36 Region: 4400-4490
Classification Level Classification E-value
Superfamily Immunoglobulin 2.71e-16
Family I set domains 0.012
Further Details:      
 
Domain Number 37 Region: 4588-4681
Classification Level Classification E-value
Superfamily Immunoglobulin 4.57e-16
Family I set domains 0.0069
Further Details:      
 
Domain Number 38 Region: 4302-4389
Classification Level Classification E-value
Superfamily Immunoglobulin 6.08e-16
Family I set domains 0.021
Further Details:      
 
Domain Number 39 Region: 2752-2843
Classification Level Classification E-value
Superfamily Immunoglobulin 9.28e-16
Family I set domains 0.01
Further Details:      
 
Domain Number 40 Region: 2269-2361
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000151
Family I set domains 0.0073
Further Details:      
 
Domain Number 41 Region: 946-1038
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000203
Family I set domains 0.0098
Further Details:      
 
Domain Number 42 Region: 4873-4966
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000163
Family I set domains 0.012
Further Details:      
 
Domain Number 43 Region: 2463-2555
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000108
Family I set domains 0.0038
Further Details:      
 
Domain Number 44 Region: 1982-2074
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000137
Family I set domains 0.008
Further Details:      
 
Domain Number 45 Region: 6407-6510
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000308
Family I set domains 0.024
Further Details:      
 
Domain Number 46 Region: 4970-5062
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000375
Family I set domains 0.037
Further Details:      
 
Domain Number 47 Region: 4782-4875
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000489
Family I set domains 0.029
Further Details:      
 
Domain Number 48 Region: 4115-4204
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000895
Family I set domains 0.02
Further Details:      
 
Domain Number 49 Region: 2563-2655
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000125
Family I set domains 0.021
Further Details:      
 
Domain Number 50 Region: 2171-2264
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000293
Family I set domains 0.0082
Further Details:      
 
Domain Number 51 Region: 4493-4584
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000432
Family I set domains 0.0057
Further Details:      
 
Domain Number 52 Region: 841-936
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000505
Family I set domains 0.0078
Further Details:      
 
Domain Number 53 Region: 3086-3183
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000105
Family I set domains 0.008
Further Details:      
 
Domain Number 54 Region: 1139-1239
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000491
Family I set domains 0.01
Further Details:      
 
Domain Number 55 Region: 61-124
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000199
Family SH3-domain 0.0023
Further Details:      
 
Domain Number 56 Region: 1885-1982
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000577
Family I set domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) C09D1.1
Sequence length 6632
Comment $ SECSG $ SQ44814 $ PDBT13961 $
Sequence
MASRRQKQFDRKYSSYRKFTATEDVNYSTHSSRSSYRSESLTSRTDGRGRSTSSEIIAGS
ESRSYPVYIAIQDYTPDKEDVEAIPLEQGQIVEVLDKKNSVRWLVRTKARPPRSGWVPGS
YFETPTEFYKQRRRTREIENVSLSDEQAALVKRDQVYHELLRSEEEFVSSLRTCVDDYIK
VLDDPEVPEAVKKNREELTLNIPELYNFHANVMLKGLNYYSDDPGKVGQTFVRLEKDFES
HVEFYKQYADTLKLLEEPEIKRFFEGLSAKNDAGASSFVDHVKEIADRMVQYQNYFKEFV
KYSARAHGSSKSIQKALELVTTIPQRVHDLEFTNNLKQHPGDTGKLGRIIRHDAFQVWEG
DEPPKLRYVFLFRNKIMFTEQDASTSPPSYTHYSSIRLDKYNIRQHTTDEDTIVLQPQEP
GLPSFRIKPKDFETSEYVRKAWLRDIAEEQEKYAAERDAISMTATSEMTASSVDFDMNAS
DQQSEFSEWSGSRKSSLFPGPEEGGPPRKKVKSPPVISPTGSSTSIYSGGSSSIDWTTTG
TTLEMQGTRVTRTQYGFRTLQESSAKMCLKVTGYPLPDITWYKDDVQLHEDERHTFYSDE
DGFFAMTIDPVQVTDTGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPAFVTKLRDKECK
EGDVIDFECEVEGWPEPELVWLVDDQPLRPSHDFRLQYDGQTAKLEIRDAQPDDTGVYTV
KIQNEFGSIESKAELFVQADPDKNHVAPEFQATIEYVECDEGEEVRFKSVITGDPNPEII
WFINGKPLSESEKVKFISEDGICILTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVP
PAPPTFNKPLEDKTVQEKSTVVFEVDVSGWPEPTLTFTLCGKELKNGEEGVEIVGHDGFY
RISIPNTSMDKHDGEIVAKAQNEHGTAESRARLTVEQEEEESRSAPTFLKDIEDQTVKTG
EFAVFETTVRGNPNPEVTWFINGHKMDQGSPGVKIEAHNHDHKLTIDSAQYAGTVLCRAE
NAVGRFETKARLVVLAPEKQKKPPKFVEILVDKTETVDNTVVFEVRVEGEPKPTVTWYLK
GEELKQSDRVEIREFDGSIKISIKNIKIEDAGEIRAVATNSEGSDETKAKLTVQKKPFAP
EFDLRPVSLTVEKGSEAVFSAHAFGIPLPTYEWSVNGRKVRDGQEGARVTRDESTVDGAS
ILTIDTATYYSEVNHLTISVVAENTLGAEETGAQLTIEPKKESVVVEKQDLSSSEVQKEI
AQQVKEASPEATTTITMETSLTSTKTTTMSTTEVTSTVGGVTVETKESESESATTVIGGG
SGGVTEGSISVSKIEVVSKTDSQTDVREGTPKRRVSFAEEELPKEVIDSDRKKKKSPSPD
KKEKSPEKTEEKPASPTKKTGEEVKSPKEKSPASPTKKEKSPAAEEVKSPTKKEKSPSSP
TKKEKSPSSPTKKTGDEVKEKSPPKSPTKKEKSPEKPEDVKSPVKKEKSPDATNIVEVSS
ETTIEKTETTMTTEMTHESEESRTSVKKEKTPEKVDEKPKSPTKKDKSPEKSITEEIKSP
VKKEKSPEKVEEKPASPTKKEKSPEKPASPTKKSENEVKSPTKKEKSPEKSVVEELKSPK
EKSPEKADDKPKSPTKKEKSPEKSATEDVKSPTKKEKSPEKVEEKPTSPTKKESSPTKKT
DDEVKSPTKKEKSPQTVEEKPASPTKKEKSPEKSVVEEVKSPKEKSPEKAEEKPKSPTKK
EKSPEKSAAEEVKSPTKKEKSPEKSAEEKPKSPTKKESSPVKMADDEVKSPTKKEKSPEK
VEEKPASPTKKEKTPEKSAAEELKSPTKKEKSPSSPTKKTGDESKEKSPEKPEEKPKSPT
PKKSPPGSPKKKKSKSPEAEKPPAPKLTRDLKLQTVNKTDLAHFEVVVEHATECKWFLDG
KEITTAQGVTVSKDDQFEFRCSIDTTMFGSGTVSVVASNAAGSVETKTELKVLETPKETK
KPEFTDKLRDMEVTKGDTVQMDVIALHSPLYKWYQNGNLLEDGKNGVTIKNEENKSSLII
PNAQDSGKITVEASNEVGSSESSAQLTVNPPSTTPIVVDGPKSVTIKETETAEFKATISG
FPAPTVKWTINEKIVEESRTITTIKTEDVYTLKISNAKIEQTGTVKVTAQNSAGQDSKQA
DLKVEPNVKAPKFKSQLTDKVADEGEPLRWNLELDGPSPGTEVSWLLNGQPLTKSDTVQV
VDHGDGTYHVTIAEAKPEMSGTLTAKAKNAAGECETSAKVTVNGGNKKPEFVQAPQNHET
TLEESVKFSAIVTGKPMPNVTWYLNNKKLIQSEEVKVKYVHETGKTSIRIQKPLMEHNGT
IRVEAENVSGKVQATAQLKVDKKTEVPKFTTNMDDRQVKEGEDVKFTANVEGYPEPSVAW
TLNGEPVSKHPNITVTDKDGEHTIEISAVTPEQAGELSCEATNPVGSKKRDVQLAVKKVG
DAPTFAKNLEDRLITEGELTLMDAKLNIVKPKPKITWLKDGVEITSDGHYKIVEEEDGSL
KLSILQTKLEDKGRITIKAESEFGVAECSASLGVVKGRPMAKPAFQSDIAPINLTEGDTL
ECKLLITGDPTPFVKWYIGTQLVCATEDTEISNANGVYTMKIHGVTADMTGKIKCVAYNK
AGEVSTEGPLKVVAPIPVEFETSLCDATCREGDTLKLRAVLLGEPEPVVSWYVNGKKLEE
SQNIKIHSEKGTYTVTIKDITCDYSGQVVCEAINEYGKATSEATLLVLPRGEPPDFLEWL
SNVRARTGTKVVHKVVFTGDPKPSLTWYINNKEILNSDLYTIVTDDKTSTLTINSFNPDV
HVGEIICKAENDAGEVSCTANMITYTSDMFSESESEAQAEEFVGDDLTEDESLREEMHRT
PTPVMAPKFITKIKDTKAKKGHSAVFECVVPDTKGVCCKWLKDGKEIELIARIRVQTRTG
PEGHITQELVLDNVTPEDAGKYTCIVENTAGKDTCEATLTVIESLEKKSEKKAPEFIVAL
QDKTTKTSEKVVLECKVIGEPKPKVSWLHDNKTITQESITVESVEGVERVTITSSELSHQ
GKYTCIAENTEGTSKTEAFLTVQGEAPVFTKELQNKELSIGEKLVLSCSVKGSPQPHVDF
YSFSETTKVETKITSSSRIAIEHDQTNTHWRMVISQITKEDIVSYKAIATNSIGTATSTS
KITTKVEAPVFEQGLKKTSVKEKEEIKMEVKVGGSAPDVEWFKDDKPVSEDGNHEMKKNP
ETGVFTLVVKQAATTDAGKYTAKASNPAGTAESSAEAEVTQSLEKPTFVRELVTTEVKIN
ETATLSVTVKGVPDPSVEWLKDGQPVQTDSSHVIAKVEGSGSYSITIKDARLEDSGKYAC
RATNPAGEAKTEANFAVVKNLVPPEFVEKLSPLEVKEKESTTLSVKVVGTPEPSVEWFKD
DTPISIDNVHVIQKQTAVGSFSLTINDARQGDVGIYSCRARNEAGEALTTANFGIIRDSI
PPEFTQKLRPLEVREQETLDLKVTVIGTPVPNVEWFKDDKPINIDNSHIFAKDEGSGHHT
LTIKQARGEDVGVYTCKATNEAGEAKTTANMAVQEEIEAPLFVQGLKPYEVEQGKPAELV
VRVEGKPEPEVKWFKDGVPIAIDNQHVIEKKGENGSHTLVIKDTNNADFGKYTCQATNKA
GKDETVGELKIPKYSFEKQTAEEVKPLFIEPLKETFAVEGDTVVLECKVNKESHPQIKFF
KNDQPVEIGQHMQLEVLEDGNIKLTIQNAKKEDVGAYRCEAVNVAGKANTNADLKIQFAA
KVEEHVTDESGQLEEIGQFETVGDTASSKTDTGRGAPEFVELLRSCTVTEKQQAILKCKV
KGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLTLTFDNVTQADAGEYRCEAENEYGSAW
TEGPIIVTLEGAPKIDGEAPDFLQPVKPAVVTVGETAVLEGKISGKPKPSVKWYKNGEEL
KPSDRVKIENLDDGTQRLTVTNAKLDDMDEYRCEASNEFGDVWSDVTLTVKEPAQVAPGF
FKELSAIQVKETETAKFECKVSGTKPDVKWFKDGTPLKEDKRVHFESTDDGTQRLVIEDS
KTDDQGNYRIEVSNDAGVANSKVPLTVVPSETLKIKKGLTDVNVTQGTKILLSVEVEGKP
KTVKWYKGTETVTSSQTTKIVQVTESEYKLEIESAEMSDTGAYRVVLSTDSFSVESSATV
TVTKAAEKISLPSFKKGLADQSVPKGTPLVLEVEIEGKPKDVKWYKNGDEIKDGKVEDLG
NGKYRLTIPDFQEKDVGEYSVTAANEAGEIESKAKVNVSAKPEIVSGLVPTTVKQGETAT
FNVKVKGPVKGVKWYKNGKEIPDAKTKDNGDGSYSLEIPNAQVEDAADYKVVVSNDAGDA
DSSAALTVKLADDGKDKVKPEIVSGLIPTTVKQGETATFNVKVKGPVKQVKWYKNGKEIP
NAKAKDNGDGSYSLEIPNAQLDDTADYKVVVSNDAGDADSSAALTVKLPGIAIVKGLEDA
EVPKGKKAVLQVETNKKPKEIKWYKNGKEITPSDKAQPGSDGDNKPQLVIPDAGDDDAAE
YKVVLTDEDGNTADSSCALTVKLPAKEPKIIKGLEDQVVSIGSPIKLEIETSGSPKTVKW
YKNGKELPGAAAKTIKIQKIDDNKYVLEIPSSVVEDTGDYKVEVANEAGSANSSGKITVE
PKITFLKPLKDQSITEGENAEFSVETNTKPRIVKWYKNGQEIKPNSRFIIEQKTDTKYQL
VIKNAVRDDADTYKIVLENTAGEAESSAQLTVKKAKAGLCKIVKGLEDQVVAKGAKMVFE
VKIQGEPEDVRWLRDANVISAGANAIIEKIDDTTYRLIIPSADLKDAGEYTVEVINESGK
AKSDAKGEVDEKPEIVRGLENIEIPEGDDDVFKVEVSAPVRQVKWYKNDQEIKPNSHLEA
KKIGPKKYELAINRAQLDDGADYKVVLSNAAGDCDSSAALTVVKPNVLKIVDGLKDVDVE
EPQPVELKVKVEGIPKVIKWYKNGQELKPDADGFKFEEKPESGEFSLTIPSSKKSDGGAY
RVVLGNDKGEVYSGSVVHVKSAKSSEPTSGANFLSPLKDTEVEEGDMLTLQCTIAGEPFP
EVIWEKDGVVLQKDDRITMRVALDGTATLRIRSAKKSDIGQYRVTAKNEAGSATSDCKVT
VTEQGEQPSKPKFVIPLKTGAALPGDKKEFNVKVRGLPKPTLQWFLNGIPIKFDDRITLD
DMADGNYCLTIRDVREEDFGTLKCIAKNENGTDETVCEFQQGAGHDDGSRDDLRYPPRFN
VPLWDRRIPVGDPMFIECHVDANPTAEVEWFKDGKKIEHTAHTEIRNTVDGACRIKIIPF
EESDIGVYMCVAVNELGQAETQATYQVEILEHVEEEKRREYAPKINPPLEDKTVNGGQPI
RLSCKVDAIPRASVVWYKDGLPLRADSRTSIQYEEDGTATLAINDSTEEDIGAYRCVATN
AHGTINTSCSVNVKVPKQEVKKEGEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFPEIKW
YRNGQLLRNGPRTVIETSPDGSCSLTVNESTMSDEGIYRCEAENAHGKAKTQATAHVQMA
LGKTEKPKMDEGKPPKFILELSDMSVSLGNVIDLECKVTGLPNPSVKWSKDGGPLIEDSR
FEWSNEASKGVYQLRIKNATVHDEGTYRCVATNENGSATTKSFVRMDDGLGSGVVTASQP
PRFTLKMGDVRTTEGQPLKLECKVDASPLPEMVWYKDGAIVTPSDRIQISLSPDGVATLL
IPSCVYDDDGIYRVIATNPSGTAQDKGTATVKKLPRDSGARRSADRDVFDANKAPKLMEP
LENIRIPEKQSFRLRCKFSGDPKPTIKWFKDGERVFPYGRLQLIESPDGVCELVVDSATR
QDAGGYRCVAENTYGSARTSCDVNVIRGDRKPRDIDSSIREGKAPGFTTPLTIRRAKPGD
SVTFECLPFGNPFPSIKWLKDGLELFSDEKIKMEAAADGTQRLILSDVTFLSEGYFRCVA
TNEHGTASTKAELVIEGDRTIGSRPLPEVNGEPEECKPRIRRGLYNMSIHEGNVVEMIVC
ATGIPTPTVKWYKDGQEIVGDGPDGKRVIFTDERGIHHLVIVNASPDDEGEYSLEATNKL
GSAKTEGSLNIIRPRHIADADERGGMPFPPGFVRQLKNKHVFNHMPTIFDCLVVGHPAPE
VEWFHNGKKIVPGGRIKIQSCGGGSHALIILDTTLEDAGEYVATAKNSHGSASSSAVLDV
TVPFLDSIKFNGEIDVTPYLTEEYGFKKLNTASLPTPPDRGPFIKEVTGHYLTLSWIPTK
RAPPRYPQVTYVIEIRELPEKQWSLLEYNIPEPVCKVRNLELGKSYQFRVRAENIYGISD
PSPASPPSRLMAPPQPVFDRRTNKVIPLLDPYAEKALDMRYSEQYACAPWFSPGVVEKRY
CAENDTLTIVLNVSGFPDPDIKWKFRGWDIDTSSPTSKCKVYTYGGSETTLAITGFSKEN
VGQYQCFAKNDYGDAQQNIMVDLATRPNFIQPLVNKTFSSAQPMRMDVRVDGEPFPELKW
MKEWRPIVESSRIKFVQDGPYLCSLIINDPMWRDSGIYSCVAVNDAGQATTSCTVTVEAE
GDYNDVELPRRRVTIESRRVRELYEISEKDEK
Download sequence
Identical sequences C09D1.1a C09D1.1a NP_001020984.1.50509 C09D1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]