SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for C35B8.2 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C35B8.2
Domain Number 1 Region: 204-424
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.89e-50
Family DBL homology domain (DH-domain) 0.0000436
Further Details:      
 
Domain Number 2 Region: 6-203
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.36e-35
Family Calponin-homology domain, CH-domain 0.0035
Further Details:      
 
Domain Number 3 Region: 754-855
Classification Level Classification E-value
Superfamily SH2 domain 3.77e-26
Family SH2 domain 0.00072
Further Details:      
 
Domain Number 4 Region: 852-930
Classification Level Classification E-value
Superfamily SH3-domain 1.17e-18
Family SH3-domain 0.00088
Further Details:      
 
Domain Number 5 Region: 414-563
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000017
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 6 Region: 615-688
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000249
Family SH3-domain 0.0062
Further Details:      
 
Domain Number 7 Region: 570-614
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000493
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) C35B8.2
Sequence length 935
Comment $ SECSG $ SQ46725 $ PDBT1472 $
Sequence
MNGGCDLWIGCARWLRDMKVLTTDKNGTMLEFASVLRDGILLCRLANTLVPNGIDQKKIM
RTNQPSPFLCCNNINYFAMFCKTYFNLEDADLFTAEDLYYMNGFQKVLKTLSFLSHTKES
LSRGVDPFPDTDNNQEGTSNGSEFEDDVEIYQSLHDNIENVDPNRTIYGPITSADPEEQQ
SEQLYDRIVTNRKPSMNENDLQNTPTLKRNRCIRELYDTEKNYVAQALVTIIKTFYEPLK
GIIPTSDYNIIFGNIEEINVLHTALLADLEYPVKVALGLSDATPPRPISLNECVPQTIGE
VFIKYRDQFLAYGKYCSNLPDSRKLSNELLKTNEFISRNINELTAQGNCKFGMNDLLCVP
FQRLTKYPLLLKELQKKTDLASPDRKSLEEAVEVMEDVCNYINEESRDTNAIKVIDEIEQ
SITDLSMPLNVKLHDYGRVNLDGEVKMAESTLTQAGKPKQRYIFLFDKVIVVCKAANKVM
AAKTTGASARTNTFTYKNAYVMSELTIDKNASLDVKSGGTITRRTQYVIIMTRDRNENNE
ITQLTFYFKNEATRNNWMTALLLSKSNVSPTDYLRDTNHKVAFHSFRVDVKNPATCDVCD
KLMKGLQYQGYKCEFHEGDIVVANSNSTPSDLSYLQFAKGDRIEVIKMQGHNRFTGCLIN
NRNRTGLVHLDHVSQSRTTSMIGLSPIDSPAGSIAPRVVRNESTVLPNKLLSDGSSRSLS
GPHGSRSSRNSSSSTINGSMDSVPRQQDYVNTEISEFLWYMGEMERAKAESTLKGTPNGT
FLVRYSKNRKQTAISLSYKNDVKHMIIEQNSDGKVYLDEDYIFNSTVELVQYYRSNNLIE
IFAALDTCLKNPYSQCKVFKAVHDYDAPSPNNEGKFLSFKTGDIVVLLDTVGEDRGWWKG
QVNNKSGFFPLSYVKPYDPATEGSSSPVTPTSSSS
Download sequence
Identical sequences C35B8.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]