SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for CgR26A from TargetDB

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CgR26A
Domain Number - Region: 1-46
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00942
Family Anti-sigma factor antagonist SpoIIaa 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) CgR26A
Sequence length 114
Comment $ NESG $ SQ201467 $ PDBT159589 $
Sequence
GQISSSDITNIQAAIDDVKASEQKVIFVVFLSSFDGVDPETWTQQALQANGGGNVLIYAL
APEERQYGIQGGTQWTDAELDAANNAAFQALSQEDWAGSALALAESVGSSSSSS
Download sequence
Identical sequences CgR26A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]