SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Cth-1803 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Cth-1803
Domain Number 1 Region: 9-103
Classification Level Classification E-value
Superfamily SpoIIaa-like 8.83e-24
Family Anti-sigma factor antagonist SpoIIaa 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Cth-1803
Sequence length 104
Comment $ SECSG $ SQ45065 $ PDBT14030 $
Sequence
MSEGLRFVEEKVDDSVKLSLFGEVDIYTSQELKEKLYSIVDNNQTDLIIDCKELNYIDST
GLGIFVGALKKTKQYGKKIIITSLKDNIKKLFIITGLDKVFVIE
Download sequence
Identical sequences A3DJG7
gi|125975379|ref|YP_001039289.1| 203119.Cthe_2898 gi|385777814|ref|YP_005686979.1| WP_003514607.1.16390 WP_003514607.1.19387 WP_003514607.1.20586 WP_003514607.1.31213 WP_003514607.1.55520 WP_003514607.1.60145 WP_003514607.1.6636 WP_003514607.1.6965 Cth-1803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]