SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CvR136 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CvR136
Domain Number 1 Region: 19-52
Classification Level Classification E-value
Superfamily ADP-ribosylation 0.0000403
Family ADP-ribosylating toxins 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) CvR136
Sequence length 60
Comment $ NESG $ SQ119889 $ PDBT141269 $
Sequence
MDSVCRAVHLGNGYRAYSPALLRFHRPDSLSPFGAGGVNGYVYCGEDPVNRTDPSGHLSW
Download sequence
Identical sequences Q7NVS9
243365.CV_2263 CvR136 gi|34497718|ref|NP_901933.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]