SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for F55C7.7C from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F55C7.7C
Domain Number 1 Region: 243-430
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-44
Family DBL homology domain (DH-domain) 0.0000248
Further Details:      
 
Domain Number 2 Region: 438-558
Classification Level Classification E-value
Superfamily PH domain-like 2.93e-24
Family Pleckstrin-homology domain (PH domain) 0.0018
Further Details:      
 
Domain Number 3 Region: 745-840
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000437
Family I set domains 0.0076
Further Details:      
 
Domain Number 4 Region: 817-919
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000267
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 5 Region: 13-77
Classification Level Classification E-value
Superfamily SH3-domain 0.000000136
Family SH3-domain 0.005
Further Details:      
 
Weak hits

Sequence:  F55C7.7C
Domain Number - Region: 632-690
Classification Level Classification E-value
Superfamily SH3-domain 0.00128
Family SH3-domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) F55C7.7C
Sequence length 928
Comment $ SECSG $ SQ48482 $ PDBT6596 $
Sequence
MVIKCFTCLRKQSSEVWIVTADFDGQVEGHLTVHKGDRVEIVEDQATDCAEYVQVVLCDQ
PTKHGLVPASIIAPPESGSVPDRPDDSNASGSTVSKRKSLRRIFANSSKERAAAANSSSS
NNNSPATRQSTSTSSPVTANGHTTESSTSAPIGVLSSGEPTSSNSIPSSSTPTHTVPSSV
PATVIPIVVAEDEKAEDCLPPPMENITINNSIDEKDMNEDSVAASDAVEPEVALPAKVEK
TPEETARFKRSYVLMELVETEQDYVKDLTSVVEGYIGNLNKMDLPADLVGKDKIIFANIV
NILEFHKTNFLKEIEKCSENYEAAGAAFVKYERRLHTLYVTYCQNKPKSDYLLAQDDFEA
FFADTKAKLGHKVALCDLLIKPVQRIMKYQLLLKDILKFTERAKDKTDTLKKALQVMHVV
PKACDDMMQVGRLQNFDKSLSAQGKLIHQGTLQISESIAGNVQKPKDRRIFLFEQSAIIA
DHIPPKKEFGNPTYIFKSQFMVNKMVFEPNVPDDPLRFVIKSSDPTQPTSFIANAQSQEE
KDEWNRKMSELLDQQKRLLAALVDPRRYNDMSSGMGDLSLGAPGGDRRGAPSSANRSAAS
SSKKPAESPKKEGKSKSSLFSFGKKPAKSPTSPPPLDAAAAGKFQKVADDQVNLETDEKV
KVLDVKNGYASVKKADGTVGKCPSYFLTMSDIPGTNFAEQIQYRREWQRRVDETDVEYGP
SAFDTATSSTDNFDVLLELTTCERPVVVEDMKDIEVVEGNDVEMCPIISSHTDFTVIWHG
PAVDSKRARIQTNQLNSRLLIKHVKKCDAGAYSVIAKNSFGVTSTVAFLSVISIPDPPTD
FTVKISGDHEVRLKWKAESGLKYCIEYRILDDSSPENWLIASTNIEKTHVSLRNFARNSY
SFRVFAYNQRVRSAPSQCICICFDGTEM
Download sequence
Identical sequences Q7JNG6
F55C7.7C F55C7.7c F55C7.7c NP_001021498.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]