SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GO.34387 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.34387
Domain Number 1 Region: 46-145
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000586
Family Canonical RBD 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GO.34387
Sequence length 176
Comment $ CESG $ SQ5363 $ PDBT210466 $
Sequence
MASLKKTISQIKLESEMETDCKAPTAGSGQECSTQEKVSAQGPQFVTGVIVKIVSGEPLP
GRKQVKDILATISEVVYIDLLEGDTECHARFKTPEDAQAVMNAQTEIRKKHSWNLEVLSG
DHEQRYWQKILVDRQAKLNQPREKKRGTEKLITKAEKIRLAKTQQASQHIRFSEYD
Download sequence
Identical sequences GO.34387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]