SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.3466 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.3466
Domain Number 1 Region: 17-121
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.28e-24
Family Flavin-binding PAS domain 0.00093
Further Details:      
 
Domain Number 2 Region: 143-252
Classification Level Classification E-value
Superfamily SpoIIaa-like 4.45e-16
Family Anti-sigma factor antagonist SpoIIaa 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GO.3466
Sequence length 253
Comment $ NYCOMPS $ SQ160133 $ PDBT336167 $
Sequence
MSAYPKFDVILKALNLSSVGVIITDPEQKNNPIIFVNTGFENITGYTKEEAIGSNCHFLQ
GDDTDKEEVAKIRHAINEKSTANVLLKNYRKNGTSFMNELTIEPIYDDNDHLYFVGIQKD
VTTEHNYQLELEKSLWEIEKLSTPIVPIKENICVLPLIGSLTHDRFQHMSDYVSEYMDNG
KEDYLIMDLSGLADFNEDAVMNLVKFHGFMKLTGVELIITGISPKFAMTLMRYQENLSSL
TTYSTIKEALQFY
Download sequence
Identical sequences Q92DM1
WP_003761135.1.46653 WP_003761135.1.51650 WP_003761135.1.67429 WP_003761135.1.70104 WP_003761135.1.83607 WP_003761135.1.99921 gi|16799866|ref|NP_470134.1| 272626.lin0792 GO.3466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]