SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.8785 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.8785
Domain Number 1 Region: 442-547
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.96e-16
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 
Weak hits

Sequence:  GO.8785
Domain Number - Region: 162-195
Classification Level Classification E-value
Superfamily Preprotein translocase SecE subunit 0.0693
Family Preprotein translocase SecE subunit 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.8785
Sequence length 551
Comment $ NYCOMPS $ SQ227439 $ PDBT340306 $
Sequence
MYKPKLISLLDDKENGFSKEQFFKDLIAGIIVAIIALPLSIALGISSGVSPEKGLITAII
AGFIISLLGGSRVQIGGPTGAFVVIVFGIIQNHGVDGLIIATFMAGIILVLFGLLRFGSL
IKYIPYPITVGFTSGIAVTLFSTQVKDFLGLSMTKTPSEFIPKWEAYISHMNTTNLYTLA
IGLLALIILIFWPKINKKIPGSLIALIVTTLVVFIFNLPVATIGSQFGKISSNIPMPHIP
NLNLNTLKALIGPAFTIALLGGIESLLSAVVSDGMIGDKHNSNAELIAQGIANMGSSLFG
GIPATGAIARTAANVKNGGRTPISGIVHSITLLLIMLVFMPLAKFIPLTTLSAILIIVSY
NMSEWRTFKAILKAPKSDIAILLTTFFLTVLFDLVIAIGIGMVVSMCLFMRRVATSIEVN
ELNESDCSDKSNIDTDMENLKVGENVLVYDIRGHLFFGAVDTFMNTMKEINDDAKVLVLR
MRHTKTLDVTGYKQIKNIALSCKSRNMTLIISELQEQPKKVMRLMGFIDTLGEDHFATNF
DEALEKANSLI
Download sequence
Identical sequences A0A0H2YUZ7 A0A1U9V8P8 B1R6X4 B1V0Y2
gi|110801327|ref|YP_696167.1| WP_003457300.1.10161 WP_003457300.1.2058 WP_003457300.1.20964 WP_003457300.1.23119 WP_003457300.1.27257 WP_003457300.1.27537 WP_003457300.1.30163 WP_003457300.1.31832 WP_003457300.1.39851 WP_003457300.1.43003 WP_003457300.1.4402 WP_003457300.1.50147 WP_003457300.1.50713 WP_003457300.1.52260 WP_003457300.1.5234 WP_003457300.1.52659 WP_003457300.1.68380 195103.CPF_1731 GO.8785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]