SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.8789 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.8789
Domain Number 1 Region: 449-563
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000765
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.8789
Sequence length 566
Comment $ NYCOMPS $ SQ227443 $ PDBT340310 $
Sequence
MSSPTRTSAKDRLSGVWALKGYKREWLRHDIVAGAALFALLVPAGMAYAQAAGLPPVTGL
YATVVPLLVYAIVGPSRILVLGPDSALAPMIAAAIVPLAAGSSEKSVALAGLLAVLIGVI
MLAGSALKLGTITGLLSKPIRLGYLNGIALLVLLSQLPAFFGIEADGDIWEKLAKVTTGV
LGGGVNVTALLLGSGSLALIWIPRLLKWKVPGVLLAVVGSCVVTAVWGLNDDVKVTGVLP
QGLPMPALGGIGWADALTLLPAAAGIALMAFADTGVLSQTLAAKEGKKVSGNREMAALGA
ANAATGLLGGFPISGSTSRTPVAVDAGAKSQMTGVVGSVLVLAFMLLAPGVTEYLPSATL
AAVVIAAAIALADPAGVKRLLSLSRSESVVMLAAFLGVLTVGVLQGIVVAIALALLDFVR
RAWDPYRTELGAEEGLPGYHDLERHPDGERIPGLLILRFDAPLFFGNGQVLAAFVREQLD
EAPDETTDAITHVILAAEPITGIDTTALDDLVTLDEWLASKGVDLVFAELKGPVKDKLIH
LGTAARFTPDHFFPTVGAAVRTLKNE
Download sequence
Identical sequences A1RAT6
gi|119960871|ref|YP_949348.1| GO.8789 WP_011776274.1.67142 290340.AAur_3661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]