SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.8799 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.8799
Domain Number 1 Region: 391-485
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000000000106
Family Anti-sigma factor antagonist SpoIIaa 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GO.8799
Sequence length 495
Comment $ NYCOMPS $ SQ227451 $ PDBT340320 $
Sequence
MTNALKQNWFSNIRGDLLAGTVVALALIPEAIAFSIIAGVDPKVGLYASFCIAVIIAFVG
GRPGMISAATGAMALLMVTLVKEHGLQYLLAATLLTGVIQIAAGYLKLGGLMRFVSRSVV
TGFVNALAILIFMAQLPELTNVTWHVYAMTAAGLAIIYLFPLIPTVGKLIPSPLVCIVGL
TIVSMVMGLDIRTVGDMGELPDTLPIFLWPDVPLTLETLMIILPYSLGLAVVGLLESLMT
ATIVDDLTDTTSDRNRECKGQGIANIGSGLLGGMAGCAMIGQSIINVKSGGRTRLSTLTA
GVFLLILVLVLDKWLVQIPMAALVAVMIMVSIGTFSWDSIRNLREHPLSTNIVMLVTVIV
VVATHNLAFGVLAGVLLAALFFANKVGHYMLVTSELDEATDTRRYTVVGQVFFSSSEKFL
ESFDFKEAVDNVVIDLSRAHFWDITAVGALDKAVIKFRREGADVEVIGLNEASATIVDRF
GVHDKPDAVDQLMGH
Download sequence
Identical sequences A1U2G3 H8W9J8 U7HQC7 U7NK20 U7P537
351348.Maqu_2102 gi|120555018|ref|YP_959369.1| gi|387813612|ref|YP_005429094.1| GO.8799 WP_011785574.1.55946 WP_011785574.1.60619 WP_011785574.1.7233 WP_011785574.1.74965 WP_011785574.1.95793

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]