SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GO.8803 from TargetDB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GO.8803
Domain Number 1 Region: 466-571
Classification Level Classification E-value
Superfamily SpoIIaa-like 5.1e-16
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GO.8803
Sequence length 578
Comment $ NYCOMPS $ SQ227454 $ PDBT340324 $
Sequence
MPHRAHLFSLRTAHAVREACVDEPYNSGRFFKDLMAGATVGIIAIPLAMALAIASGVAPQ
YGLYTAIIAGFLIALFGGSRYSISGPTAAFVVILYPIAQSYGLGGLLLATLMSGVLLVIM
AVMRLGRFIEYIPESVTLGFTGGIAVVIATLQVKDFFGLSIDAMPEHYWDKLAVLGQQLP
ALDGLSTLVAVVTLAVMLLWPRLRTPVPPHLPAVIVGSLLALWLNAGGAAIETVGSRFSY
LLPDGSTGAGIPPFLPEFAWPWQQAGADGRPIGLSWDLFRELIPAAFAIAMLGAIESLLC
AVVLDGMTGKRHSANSELMGQGIGNIVVPFFGGITATAAIARSAANYRAGAESPVAAMIH
ALVVLLALVSLAGILAYLPMPAMAALLVMVAWNMSEAAKAVHLLRTAPRSDILVFLTCFG
LTVALDMVIAITTGVLLAAVLFMREMAQMTRVTDITGNKRVQQVGVPEGWQVFKINGPLF
FAAADRIFGELADLSQQAEGLVLYMDGVTILDAGGLAALNKLIASCRKTGTRIVIADLQF
QPLRTLARAGVKPEPGVSYFYPTLEAALAELSEMDWQT
Download sequence
Identical sequences A1U6C2
GO.8803 gi|120556377|ref|YP_960728.1| WP_011786882.1.7233 351348.Maqu_3470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]